KEGG   Delphinapterus leucas (beluga whale): 111164824
Entry
111164824         CDS       T05885                                 

Definition
(RefSeq) histone deacetylase 2-like isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04213  Longevity regulating pathway - multiple species
dle04330  Notch signaling pathway
dle04613  Neutrophil extracellular trap formation
dle04919  Thyroid hormone signaling pathway
dle05016  Huntington disease
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111164824
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111164824
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111164824
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111164824
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111164824
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164824
   05202 Transcriptional misregulation in cancer
    111164824
   05206 MicroRNAs in cancer
    111164824
   05203 Viral carcinogenesis
    111164824
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111164824
  09164 Neurodegenerative disease
   05016 Huntington disease
    111164824
  09165 Substance dependence
   05031 Amphetamine addiction
    111164824
   05034 Alcoholism
    111164824
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111164824
   05165 Human papillomavirus infection
    111164824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111164824
Enzymes [BR:dle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     111164824
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     111164824
   HDAC complexes
    Sin3A-HDAC complex
     111164824
    BRAF-HDAC complex
     111164824
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111164824
  Chromatin remodeling factors
   NuRD complex
    111164824
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 111164824
NCBI-ProteinID: XP_022410448
UniProt: A0A2Y9LZ33
LinkDB
Position
Unknown
AA seq 260 aa
MRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEV
VKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISP
SNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISI
RASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSK
DNSGEKTDTKGAKSEQLSNP
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagagatggtatagatgatgaatcatatgggcagatatttaagcctattatttcaaaa
gtgatggagatgtatcaacctagtgctgtggtgctacagtgtggtgcagactcactatcc
ggtgatagacttggttgcttcaatttgacagtcaaaggtcatgctaaatgtgtagaagtt
gtaaaaactttcaatttaccattactgatgcttgggggaggtggatacacaatccgcaat
gttgctcgatgttggacatatgagactgctgttgcccttgattgtgagattcccaatgaa
ttgccatataatgattactttgagtattttggaccagacttcaaactgcatattagtcct
tcaaacatgacaaaccagaacactccagaatatatggaaaagataaaacagcgtttattt
gaaaatttacgcatgttgccacatgcacctggagtccaaatgcaagctattccagaagat
gcagttcatgaagacagtggagatgaagatggagaagatccagacaagagaatttctatt
cgagcatcagacaaacggatagcttgtgatgaagaattctcagattctgaggacgaagga
gagggaggtcgtagaaatgtggctgatcataagaaaggagcaaagaaagctagaattgaa
gaagacaagaaggaaacggaggacaaaaaaacagatgttaaagaagaagataagtccaag
gacaatagtggtgaaaaaacagataccaaaggagccaaatcagaacagctcagcaaccct
tga

KEGG   Delphinapterus leucas (beluga whale): 111164829
Entry
111164829         CDS       T05885                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04213  Longevity regulating pathway - multiple species
dle04330  Notch signaling pathway
dle04613  Neutrophil extracellular trap formation
dle04919  Thyroid hormone signaling pathway
dle05016  Huntington disease
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111164829
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111164829
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111164829
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111164829
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111164829
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164829
   05202 Transcriptional misregulation in cancer
    111164829
   05206 MicroRNAs in cancer
    111164829
   05203 Viral carcinogenesis
    111164829
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111164829
  09164 Neurodegenerative disease
   05016 Huntington disease
    111164829
  09165 Substance dependence
   05031 Amphetamine addiction
    111164829
   05034 Alcoholism
    111164829
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111164829
   05165 Human papillomavirus infection
    111164829
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111164829
Enzymes [BR:dle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     111164829
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     111164829
   HDAC complexes
    Sin3A-HDAC complex
     111164829
    BRAF-HDAC complex
     111164829
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111164829
  Chromatin remodeling factors
   NuRD complex
    111164829
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 111164829
NCBI-ProteinID: XP_022410471
UniProt: A0A2Y9LP02
LinkDB
Position
Unknown
AA seq 473 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTVYSCVLIDIQKFQL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttgtatagaaaaatggaaatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagcgatgagtacatcaaatttctgcgttcaata
agaccagataacatgtccgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatgggctctttgagttttgtcagctttcaactggtggttcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacgggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcatatgggcag
atatttaagcctattatttcaaaagtgatggagatgtatcaacctagtgctgtggtgcta
cagtgtggtgcagactcactatccggtgatagacttggttgcttcaatttgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggtggatacacaatccgcaatgttgctcgatgttggacatatgagactgctgttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttgccacatgcacctggagtc
caaatgcaagctattccagaagatgcagttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggacgaaggagagggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagacaagaaggaaacggaggacaaaaaaacagtc
tactcttgtgtactgattgacatccagaaattccagctgtga

KEGG   Delphinapterus leucas (beluga whale): 111175514
Entry
111175514         CDS       T05885                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04213  Longevity regulating pathway - multiple species
dle04330  Notch signaling pathway
dle04613  Neutrophil extracellular trap formation
dle04919  Thyroid hormone signaling pathway
dle05016  Huntington disease
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05165  Human papillomavirus infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111175514 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111175514 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111175514 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111175514 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111175514 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175514 (HDAC1)
   05202 Transcriptional misregulation in cancer
    111175514 (HDAC1)
   05206 MicroRNAs in cancer
    111175514 (HDAC1)
   05203 Viral carcinogenesis
    111175514 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111175514 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111175514 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    111175514 (HDAC1)
   05034 Alcoholism
    111175514 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111175514 (HDAC1)
   05165 Human papillomavirus infection
    111175514 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111175514 (HDAC1)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     111175514 (HDAC1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     111175514 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     111175514 (HDAC1)
    BRAF-HDAC complex
     111175514 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111175514 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    111175514 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 111175514
NCBI-ProteinID: XP_022430799
UniProt: A0A2Y9N7S9
LinkDB
Position
Unknown
AA seq 393 aa
MFFQVNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAI
PEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEK
EKDPEEKKEVTEEEKTKEEKQEAKGVKEEVKLA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgttttttcaagttaacgttggtgaggactgtccggtatttgatggcctctttgagttc
tgtcagctatctactggtggctctgtggcaagtgccgtgaaacttaataagcagcagacg
gacatcgctgtgaattgggctgggggcctacaccatgcaaagaagtccgaggcatctggc
ttctgttacgtcaatgatatcgtcttggccatcctggaactgctaaagtatcaccagagg
gtgctgtatattgacattgatattcaccacggcgatggcgtggaagaggccttctatacc
acagaccgagtcatgactgtgtcctttcataaatatggagagtacttcccaggaactggg
gacctacgggatattggggctggcaaaggcaagtattatgctgttaactacccgctccga
gatgggattgatgacgagtcctatgaagccattttcaagccggtcatgtccaaagtaatg
gagatgttccagcccagtgcagtcgtcttacagtgtggctctgactccttgtctggtgat
cggttaggttgcttcaatttgaccatcaaagggcacgccaagtgtgtggaatttgtgaag
agcttcaacctgcctatgctgatgctgggaggaggtggctacaccattcgtaatgtcgcc
cggtgctggacatacgaaacagctgtggccctggacacagagatccctaatgagcttcca
tacaatgactacttcgaatactttggaccagatttcaaacttcatatcagtccttccaat
atgactaaccagaacactaatgagtacctggaaaagatcaaacagcgactgtttgagaac
ctgagaatgctgccccacgcgcctggggtccaaatgcaggccattcctgaggatgccatt
ccagaggagagtggcgatgaggatgaagaagaccctgacaagcgcatttcaatctgttcc
tcggacaaacgaattgcctgtgaggaagagttctccgactctgacgaggagggagaaggc
ggtcgcaagaactcttccaacttcaaaaaagccaagagagtcaaaacagaagatgagaaa
gagaaagacccagaagagaagaaagaagtcacagaagaggagaaaaccaaggaggagaag
caagaagccaaaggggtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system