KEGG   Delphinapterus leucas (beluga whale): 111164988
Entry
111164988         CDS       T05885                                 

Gene name
RBL2
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoblastoma-like protein 2
  KO
K16332  retinoblastoma-like protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04151  PI3K-Akt signaling pathway
dle04218  Cellular senescence
dle05165  Human papillomavirus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111164988 (RBL2)
   04151 PI3K-Akt signaling pathway
    111164988 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111164988 (RBL2)
   04218 Cellular senescence
    111164988 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111164988 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111164988 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111164988 (RBL2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    111164988 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Other DBs
NCBI-GeneID: 111164988
NCBI-ProteinID: XP_022410784
UniProt: A0A2Y9LM68
LinkDB
Position
Unknown
AA seq 1141 aa
MPSGGNQSPPPPPPPLPAAAASDEEEEEDAEAEDAAQSARSPAPQTQQRFDELCSRLNMD
EAARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILR
CSEQSLIEFFHKMKKWEDMANLPAQFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQE
EQPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGN
ALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHFWK
PYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAE
EEIGTLSRCLNTGSGTETAERVQMKSILQQHFDKSKALRISTPLTGVRYIKGNSPCVTPV
STATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMYEIYSQHSQPDED
ISNCAKEIASRHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEV
VTFSYKPPGNFPCITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAW
KPESPLWDRIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVSEVRADAGGLGRS
ITSPTTLYDRYSSPTASSTRRRLFVENDSPTDGGTPGRIPPQPLVNAVPVQNVSGEAVSV
TPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQP
LSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGLPLTSSNIRPRKTSSLSLF
FRKVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVM
AKVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKD
RTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDVEEEERGDLIQFYNNIYIKQIKT
FAMKYSQANAMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNEAMLSPREKIFYYFS
NSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGS
H
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgccgtcgggaggcaaccaatcgccgccgccgcccccccctccccttccggcggcggcg
gcctcagatgaggaggaggaggaggatgctgaggcggaggacgcagcgcagtcggcccgg
tcgccggcccctcagacccaacagcggttcgacgagctgtgcagccgcctgaacatggac
gaggcggctcgggccgaggcctgggacagctacaggagcatgagcgagagctacacgctg
gagggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgtg
ccaactgtaagcaaagggacagttgaaggaaactatgtatctttaactagaatcctgaga
tgttcagagcagagcttaattgaattttttcacaagatgaagaaatgggaagacatggca
aacctacccgcacagttcagagaacggactgagagattagaaagaaacttcactgtttct
gctgtaatctttaagaaatatgaacccatttttcaggacatttttaaatatcctcaagag
gagcagcctcgtcaacaaagaggaagaaaacagcggcgacagccctgtaccgtgtctgaa
gttttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagt
gatgatctggttaattcttatcatcttctgctgtgtgctttggacttagtttatggaaat
gcccttcaatgttccaatcgtaaagaacttgtgaaccctaattttaaaggtctatctgaa
gattttcacgctaaggattctaaaccttcttccgacccaccttgtgtcattgagaaactc
tgttccttacatgacggcctagttttggaagcaaagggaataaaggaacatttctggaaa
ccttatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatcttact
ggttttttagaacctgggaattttggagagagttttaaagccatcaataaggcctatgag
gagtatgttttatctgttgggaatttagatgagcggatctttcttggagaggatgctgaa
gaggaaattgggaccctctcaaggtgtttgaatactggttcaggaacagagactgctgaa
agggtgcagatgaaaagcatcttgcagcagcactttgacaagtctaaagcacttaggatc
tctaccccacttactggtgtgaggtacattaagggtaacagcccttgtgtgactccagtt
tctacagctacacatagcttgagtcgtcttcacaccatgctcacaggcctcaggaatgca
ccaagtgagaaactggaacagattctaaggacatgttccagagatccaacccaggctata
gccaacagattgaaagaaatgtatgaaatatattctcagcattcccagccagatgaggat
atcagtaattgtgctaaagaaattgccagcagacattttcgttttgcagagatgctttac
tataaagtgttagaatctgttattgagcaggaacaaaaaagactgggagacatggattta
tctggcattctggaacaagatgcattccacagatcgctcttggcctgctgccttgaggtc
gtcactttttcttataagcctcctgggaattttccatgtattactgaaatatttgatgta
ccactttatcatttttacaaggtgatagaagtattcattagagcagaagatggcctttgt
agagaggtggtaaaacaccttaatcagattgaagaacagatcttggatcatttggcatgg
aaaccagagtctccactctgggacagaattagagacaatgaaaacagagttcctacatgt
gaagaggtcatgccacctcagaacctagaaagagcggatgaaatttgtattgctggctcc
cctttgactcccagaagggtgagtgaagttcgtgctgatgctggaggacttggaagaagc
ataacgtctccaaccacattatacgataggtacagctccccaacagccagctctaccaga
aggcggctatttgttgagaatgatagccccactgatggagggacacctggccgcatcccc
ccacagcctctagtcaatgctgtccctgtgcagaatgtatctggggaagctgtttctgtc
acaccagttcctggacagactttggtcaccatggcaacagccactgtcacagccaacaat
ggacaaacagtgactattcctgtacaaggcattgccaatgaaaatggaggaataacattc
ttcccagtccaagtcaatgttggggggcaggcacaagctgtgactggctccatccagccc
ctcagtgctcaggccctggctggaagtttaagctctcaacaggtgacaggaacgaccttg
caagtccctggtcaggtggccattcaacagatttccccaggtggacaacagcagaaacaa
ggcctacctttaaccagcagcaatattagacccaggaagaccagctctttatcgcttttc
tttagaaaggtttatcacttagcaggtgtccgtcttcgggacctttgtgctaaattggat
atttcagatgaactgaggaaaaaaatctggacctgctttgaattctccataattcagtgt
cctgaacttatgatggacagacatctggaccagttgttaatgtgtgccatttatgtgatg
gcaaaggtcacaaaagaagacaagtccttccagaatattatgcgttgctataggactcag
ccgcaggcccggagccaggtgtatagaagtgttctgataaaagggaaaaggaaaagaaga
aattctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagac
agaaccagtagagactccagtcctgtcatgaggtcaagcagcaccttgccagttccacag
cctagcagtgcccctcctacacctactcgtctcacaggtgccaacagtgatgtggaagag
gaggagaggggagaccttattcagttctacaacaacatctacataaaacaaattaaaaca
tttgccatgaagtactcacaggcaaatgcaatggatgctcctccactctctccctatccg
tttgtaagaacaggctctcctcgccgaatacagctgtctcaaaatcatcctgtgtacata
tccccacataaaaatgaagcaatgctttctcctcgagaaaagattttctactacttcagc
aacagtccttcaaagagactgagagaaattaacagtatgatacggacaggagaaacgcca
accaaaaagagagggattcttctggaagatggaagtgaatcacctgcaaaaagaatttgc
ccagaaaatcattctgccttattacgccgtctccaagatgtagctaatgaccgaggttcc
cactga

DBGET integrated database retrieval system