KEGG   Delphinapterus leucas (beluga whale): 111165046
Entry
111165046         CDS       T05885                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04062  Chemokine signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04670  Leukocyte transendothelial migration
dle04810  Regulation of actin cytoskeleton
dle04935  Growth hormone synthesis, secretion and action
dle05100  Bacterial invasion of epithelial cells
dle05135  Yersinia infection
dle05146  Amoebiasis
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05205  Proteoglycans in cancer
dle05222  Small cell lung cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111165046 (PTK2)
   04370 VEGF signaling pathway
    111165046 (PTK2)
   04151 PI3K-Akt signaling pathway
    111165046 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165046 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111165046 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111165046 (PTK2)
   04062 Chemokine signaling pathway
    111165046 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111165046 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    111165046 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165046 (PTK2)
   05202 Transcriptional misregulation in cancer
    111165046 (PTK2)
   05205 Proteoglycans in cancer
    111165046 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111165046 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111165046 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111165046 (PTK2)
   05100 Bacterial invasion of epithelial cells
    111165046 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111165046 (PTK2)
   05163 Human cytomegalovirus infection
    111165046 (PTK2)
   05165 Human papillomavirus infection
    111165046 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111165046 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111165046 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111165046 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111165046 (PTK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111165046 (PTK2)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  FAK family
   111165046 (PTK2)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111165046 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 111165046
NCBI-ProteinID: XP_022410924
UniProt: A0A2Y9LMK4
LinkDB
Position
Unknown
AA seq 1112 aa
MLFEVTGRGALGPTGAVCMEKSGCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEVADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTL
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIE
LGRCIGEGQFGDVHQGAYTSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHI
VKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFV
HRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSAS
DVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDP
SRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSP
RSSEGFHPSPQHMVQTNHYQVSGYPGSHGITAVAGSIYPGQASLLDQTDSWNHRPQEISM
WQPNVEDSATLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGS
IDREDGGPQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSSLASLGSPGDNYNEGVK
PWRLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKRM
LTAAHALAVDAKNLLDVIDQARMKALGQARPR
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgttgttcgaagtgacgggccgaggggccctgggacccacaggtgctgtctgtatggag
aagagcggctgtagtccatttccagtgtgttgggctaaagaatatgacagatacctagca
tctagcaaaataatggcagctgcttaccttgacccaaacttgaatcacacaccgaattca
agtaccaagactcacctgggtaccggtgtagaacgttcccctggggccatggagcgagtg
ttgaaggtctttcattattttgaaagcaacagtgagccaaccacttgggccagtattatc
aggcatggagacgctactgacgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcggtcagaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagacaagccaactctgaatttcttctatcaacaggtgaagagcgattatatg
ttggaggtcgctgatcaagtggaccaggacattgctttgaagttgggttgtctagaaata
cggcggtcgtactgggagatgcggggcaacgccctggagaagaagtctaactatgaagta
ttagaaaaagatgttggtttgaagcgattttttcctaggagtttactggactcagtcaag
gccaaaacactaagaaaattgattcaacaaacatttagacagtttgccaaccttaataga
gaagaaagtattttgaaattctttgagatcctctccccagtgtacagatttgataaagaa
tgcttcaagtgtgcccttggttcgagctggattatttcggtggagctggcgattggcccc
gaagaagggatcagttacctcacagacaagggctgcaaccccacacacctggccgacttc
aatcaagtgcagaccattcagtattcaaacagcgaagacaaggacaggaaggggacactg
cagctgaagattgcaggagcgcctgagcctctgacggtgacagcaccgtccctgaccatt
gccgagaacatggccgacctgatagatgggtactgccggctggtgcacggggccacgcag
tctttcatcatcaggcctcagaaagaaggtgaacgggctttgccgtcgataccaaagctg
gccaacagcgagaagcagggcgttcggacccacgctgtctctgtgtcagatgaaattagt
ggggacgaaacagacgactatgctgagatcatcgacgaggaagatacctacaccatgccc
tcgaaaagctatggaatagatgaagccagggactatgagattcagagagaaagaatagaa
ctgggacggtgcatcggagagggccagttcggagacgtgcaccaaggcgcttacacgagc
ccggagaatccagctttggcggttgcaattaaaacatgtaaaaactgtacttcggacagc
gtgagagagaaattccttcaagaagccttaacgatgcgtcagtttgaccaccctcacatt
gtgaagctgatcggagtcatcacagagaaccccgtctggatcatcatggagctgtgtacg
ctcggagagctgaggtcatttctgcaagtaaggaaatacagtttggatctagcatctctg
atcctctatgcctatcagcttagcacagcccttgcgtacctagagagcaaaagatttgtg
cacagggacattgctgctcggaatgttctggtgtcctcaaacgattgtgtaaaattagga
gacttcggattatcccgatatatggaagacagtacttactacaaagcttccaaaggaaaa
ttgcctattaaatggatggctccagagtcaatcaattttcgccgttttacctcagctagt
gacgtatggatgtttggtgtgtgtatgtgggagatactgatgcacggtgtgaagcccttt
caaggcgtgaagaacaatgatgtgattggtcgcattgagaacggggagaggttgcccatg
cctccgaactgccctcccaccctctacagcctcatgaccaagtgctgggcctacgacccc
agccggcggcctcgcttcactgagctcaaagctcagctcagcacaatcctggaggaagag
aaggtccagcaagaagaacggatgaggatggagtccagaaggcaggtcacagtgtcctgg
gactctggagggtccgacgaagcaccacccaagcccagcagacctggttatcctagtccg
aggtccagcgaagggtttcatcccagcccacagcacatggtacagaccaatcactaccag
gtctccggctaccctggctcacatggaatcacagccgtggctggcagcatctacccaggc
caggcatctcttttggaccaaacagattcgtggaatcacagaccacaggagatatcgatg
tggcagcccaacgtggaggactctgcaacactggacctgcgtggcatcgggcaggtgctg
ccgacccacctgatggaggagcggctgatccggcagcagcaggagatggaagaggaccag
cgctggctggagaaggaggagaggtttctgaaacctgacgtgcggctctctcgaggcagc
atcgacagggaggatggaggtcctcagggcccgactggaaaccagcacatatatcagcct
gtgggcaaaccagatcctgcagctccaccaaagaaaccaccgcgtcccggagcccctggg
cacctgagcagccttgccagcctcggcagccccggagacaattacaacgagggtgtcaag
ccgtggaggcttcagccccaggaaatcagcccccctcccactgccaacctggaccggtcc
aatgacagggtgtatgagaacgtgacgggcctggtgagagcggtcatcgagatgtccagc
aagatccagccagccccgccagaggagtatgtccccatggtgaaggaagtcggcttggcc
ctgaggacgctgttggccaccgtggatgagaccattcccgtcctgcccgccagcacccac
cgagagattgagatggcccagaagctgctgaactccgacctgggggagctcatcagcaag
atgaagctggcccagcagtatgtcatgaccagcctgcagcaggagtacaagaagcggatg
ctgacggccgcacacgccctggccgtggacgccaagaacctgctcgacgtcatcgaccag
gccaggatgaaggccctggggcaggcgaggccacgctga

DBGET integrated database retrieval system