KEGG   Delphinapterus leucas (beluga whale): 111165393
Entry
111165393         CDS       T05885                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05132  Salmonella infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111165393 (TCF7L1)
   04390 Hippo signaling pathway
    111165393 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111165393 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111165393 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165393 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111165393 (TCF7L1)
   05225 Hepatocellular carcinoma
    111165393 (TCF7L1)
   05226 Gastric cancer
    111165393 (TCF7L1)
   05216 Thyroid cancer
    111165393 (TCF7L1)
   05221 Acute myeloid leukemia
    111165393 (TCF7L1)
   05217 Basal cell carcinoma
    111165393 (TCF7L1)
   05215 Prostate cancer
    111165393 (TCF7L1)
   05213 Endometrial cancer
    111165393 (TCF7L1)
   05224 Breast cancer
    111165393 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111165393 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111165393 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111165393 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111165393 (TCF7L1)
   05165 Human papillomavirus infection
    111165393 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111165393 (TCF7L1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111165393 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 111165393
NCBI-ProteinID: XP_022411702
UniProt: A0A2Y9LXC6
LinkDB
Position
Unknown
AA seq 601 aa
MPQLGGGGGGGGAGGGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSVSAQRDLD
EVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGYP
FLMIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPASATVKDTRSPSPAHLHLCRKEKT
SVKGTKIKSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHP
SELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSR
FSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVIAKSPVTVKKEEEKKPHVK
KPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHS
QLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEADGALASKSKKPCVQYLPPEKPCDS
PASSHGSMLDSPATPSTALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSATFLSAKA
AATSSGQMCSQPPILSRPLPLGSVPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSA
H
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcgggggaggcgccggcggcggcggctcgggcgcc
ggggcggccggcggaggggacgacctcggggccaacgacgagctgatccccttccaggac
gaggggggcgaggagcaggagccgagcagcgacagcgtctcggcgcagcgggacctggac
gaagtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcggag
gcggagaggcgtccgcagcccgcccgggacgctttccagaagccgcgggactatttcgcc
gaagtgagaaggccccaggacggcgcgttctttaagggtcccccctaccctgggtacccg
ttcctgatgataccggacctgagcagcccgtacctccccaacggacccctgtctccggga
ggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtccccgccagcgccacg
gtcaaggataccaggtcaccgtccccagcacacttgcatctatgcaggaaggaaaagacc
agtgtcaaaggaacaaaaataaagtctaataaagttcctgttgttcaacacccgcaccac
atgcacccgttgacgcccctcatcacctacagcaacgaccacttctcccctggctcccct
cccacacacctctccccagagatcgatccaaagacaggaatcccccggccccctcaccca
tctgagctgtctccgtattacccactgtctcccggagctgtcgggcaaatcccccatccc
ctcggctggctcgtcccacagcaaggacagcccatgtactcccttcctcccggcggcttc
cggcacccctaccctgcgctcgccatgaatgcctcaatgtccagcctggtttccagtcgg
ttctcccctcacatggtggctccggcccatcctggtctgcccacctcagggatcccccac
cccgctatcgtctcccccatcgtcaagcaggaaccggcgccccccagcctgagcccggcc
gtgatcgcgaaatcacccgtcacagtgaaaaaagaggaagaaaagaaaccccacgtgaag
aagcctcttaatgccttcatgttatatatgaaggagatgagggccaaggtggtggccgag
tgcaccctgaaggaaagtgcagccattaaccagatcctggggagaaagtggcacaacctg
tcccgagaagagcaggccaagtactacgaactggcccggaaggagcggcagcttcactca
cagctctacccgacctggtcagcccgagacaactacggtaagaaaaagaagaggaagcga
gaaaagcagctgtcccagacccagtcccagcagcaagtccaggaggcagacggtgctctg
gcctccaaaagcaagaagccatgtgtccagtacctgccccctgagaagccctgtgacagt
cctgcctcctcccatggcagcatgctggactcgccggccacaccctccacggccttggcc
tccccggctgccccggccgccacccactcagagcaagcccagcccctctccctcaccacc
aagccagagacccgggcccagctggctctccactcggctaccttcctgtcagcgaaggct
gccgccacctcctctggccagatgtgcagccagccccccatcctgtcccggcccctcccc
cttgggtccgtgcccacagctctgctgacgtcccccccttccttcccagccacgctccat
gcccaccaggccctccccgtgctccaggcccagcctctttccttggtcaccaagtctgcc
cactaa

KEGG   Delphinapterus leucas (beluga whale): 111171490
Entry
111171490         CDS       T05885                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05132  Salmonella infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111171490 (LEF1)
   04390 Hippo signaling pathway
    111171490 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111171490 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111171490 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171490 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111171490 (LEF1)
   05225 Hepatocellular carcinoma
    111171490 (LEF1)
   05226 Gastric cancer
    111171490 (LEF1)
   05216 Thyroid cancer
    111171490 (LEF1)
   05221 Acute myeloid leukemia
    111171490 (LEF1)
   05217 Basal cell carcinoma
    111171490 (LEF1)
   05215 Prostate cancer
    111171490 (LEF1)
   05213 Endometrial cancer
    111171490 (LEF1)
   05224 Breast cancer
    111171490 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111171490 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111171490 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111171490 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171490 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111171490 (LEF1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111171490 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111171490
NCBI-ProteinID: XP_022422805
UniProt: A0A2Y9MLC4
LinkDB
Position
Unknown
AA seq 414 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQDSYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVSS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPVTGGFRQPYPSSLSVDTSMS
RFSPHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHADSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaagacgagggcgatccccagaaggagaagattttcgccgaa
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggttaacgaa
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gactcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatggagga
ctctacaacaagggaccctcttactcgagttattccgggtacataatgatgccaaacatg
aataatgacccatacatgtcaaatggatctctttctccgcccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccacgcagtccatcctctcacccccctcatcacttac
agcgacgagcacttttctccaggatcacacccgtcacacatcccatcggatgtcagctcc
aaacaaggcatgtccagacatcctccagctcccgagatccctaccttctatcccctgtct
ccgggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatatccc
gtcacgggaggcttcaggcaaccctacccatcctccctgtcagtcgacacttccatgtcc
aggttttctcctcatatgattcctggtcctcccggtccccacacaactggcatcccacat
ccagctatcgtaacacctcaggtcaaacaggaacacccgcacgctgacagcgacctaatg
cacgtgaagcctcagcatgaacagaggaaggagcaggagcccaagagacctcacatcaag
aagcctctgaatgcctttatgttatacatgaaagaaatgagagcgaatgtcgtagctgag
tgcaccctaaaggaaagtgccgctatcaaccagattctaggcagaaggtggcatgccctc
tctcgtgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaagctccaggaatctacatcaggtggaaaacgaagctcattccccacgtgcaaagcc
aaggcagcgaccccgggacctctcctggagatggaagcttgttga

KEGG   Delphinapterus leucas (beluga whale): 111172300
Entry
111172300         CDS       T05885                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05132  Salmonella infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111172300 (TCF7L2)
   04390 Hippo signaling pathway
    111172300 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111172300 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111172300 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172300 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111172300 (TCF7L2)
   05225 Hepatocellular carcinoma
    111172300 (TCF7L2)
   05226 Gastric cancer
    111172300 (TCF7L2)
   05216 Thyroid cancer
    111172300 (TCF7L2)
   05221 Acute myeloid leukemia
    111172300 (TCF7L2)
   05217 Basal cell carcinoma
    111172300 (TCF7L2)
   05215 Prostate cancer
    111172300 (TCF7L2)
   05213 Endometrial cancer
    111172300 (TCF7L2)
   05224 Breast cancer
    111172300 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111172300 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111172300 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111172300 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111172300 (TCF7L2)
   05165 Human papillomavirus infection
    111172300 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111172300 (TCF7L2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111172300 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111172300
NCBI-ProteinID: XP_022424432
UniProt: A0A2Y9MZC9
LinkDB
Position
Unknown
AA seq 668 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLYFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGAVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDANTPKKCRALFGLDRQTLWCKPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLP
MMPPPPALLLAEAAHGKAPALCANGALDLPPAIPPSSLAQPSTSSLHSHGSLAGTQPQPL
SLVTKSLE
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaagaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccctttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctctattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctgaaggatgcccgttctccgtcgccg
gcacatattgtccagtgccccctcccttgctgcactcagggacatgactgtcagcacttc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccat
tccttacaaaaggttggggagccctggtgtttggagtcgaacaaagtaccggttgtgcag
caccctcaccatgtccaccccctcacgcctcttatcacgtacagcaatgaacacttcacg
ccgggaaacccgcctccacacttaccagctgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatctccatattacccgctatcgcccggcgctgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagccagtgtaccccatcacg
acaggaggattccgtcacccctaccccacagctctgactgtcaacgcttccatgtccagc
tttctgtcttctaggttccccccccatatggtcccaccacatcatactctacacacgacc
ggcattccccacccggccatagtcacaccgacagtcaaacaggaatcttcccagagtgac
gtcggctcactccacagcgcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaacgcattcatgttgtatatgaaggaaatgagagcaaag
gttgtagccgagtgcacattgaaagaaagtgcagccatcaaccagatcctgggccgaagg
tggcacgcactgtccagagaagagcaagcgaaatactacgagctggcccggaaggagcga
cagcttcacatgcagctgtaccccggctggtccgcacgggataactatgggaagaagaag
aagaggaaaagggacaagcagcccggggagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagatgcaaatactccaaagaagtgtcgggcactg
ttcgggcttgaccgacagactttatggtgcaaaccgtgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgcctccttcctcccccaacctgctaggctcccctccccaagacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgatcccctggcccacctgccc
atgatgcctccgccgcccgcccttctgcttgccgaggccgcccacggcaaggcccccgcc
ctctgtgccaacggggccctggacctgcctcccgccatccctccctcatctctggcgcag
ccgtcgacatcttccttacattcccacggctctctggccgggacgcagccgcagccgctc
tccctcgtcaccaagtctttagaatag

KEGG   Delphinapterus leucas (beluga whale): 111182442
Entry
111182442         CDS       T05885                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04310  Wnt signaling pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04916  Melanogenesis
dle04934  Cushing syndrome
dle05132  Salmonella infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05221  Acute myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111182442 (TCF7)
   04390 Hippo signaling pathway
    111182442 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111182442 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    111182442 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111182442 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182442 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111182442 (TCF7)
   05225 Hepatocellular carcinoma
    111182442 (TCF7)
   05226 Gastric cancer
    111182442 (TCF7)
   05216 Thyroid cancer
    111182442 (TCF7)
   05221 Acute myeloid leukemia
    111182442 (TCF7)
   05217 Basal cell carcinoma
    111182442 (TCF7)
   05215 Prostate cancer
    111182442 (TCF7)
   05213 Endometrial cancer
    111182442 (TCF7)
   05224 Breast cancer
    111182442 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111182442 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111182442 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111182442 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111182442 (TCF7)
   05165 Human papillomavirus infection
    111182442 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111182442 (TCF7)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    111182442 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 111182442
NCBI-ProteinID: XP_022444514
UniProt: A0A2Y9PC81
LinkDB
Position
Unknown
AA seq 415 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGDAGVPGAGAGARGEAEALGREHTSQRLFPDKLPESLEDGLKTPECASGMYKDTVYS
AFNLLMHYPPPSGAGQHPQPQPSLHNKASQPSHGVPQLSPLYDHFSSPHPTPAPADISQK
QGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAP
YPRFTHPPLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKAEKEAKKPTI
KKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLH
MQLYPGWSARDNYGKKKRRSREKHQESNTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcctcagctggactcgggcgggggcggcgcgggcggcggcgacgacctcggcgcgccc
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggccgagctcaagtcgtcgctcgtcaatgagtccgag
ggcgcggccggcgacgcgggggtcccgggggcgggcgccggtgcccgcggcgaggccgag
gctctcgggcgggaacacacttcgcagagacttttccccgacaaacttccagagtctctg
gaagacggcctgaagaccccggagtgcgccagcggcatgtacaaagacaccgtctactcc
gccttcaatctgctcatgcactacccacccccctcgggagcagggcagcacccccagccg
cagccctcgctgcacaacaaggccagtcagccttcccacggcgttccccaactctctcct
ctctatgaccatttcagcagcccacaccccacacctgctccagccgacatcagccagaag
caaggagttcacaggcctctgcagacccctgacctctctggcttctactctctgacctca
ggcagcatgggacagctcccgcacactgtaagctggcccagccctcctctctaccccctg
tccccttcctgcggatatagacagcacttccccgcccccaccgcagcccctggcgccccc
taccccaggttcacccatccacccctgatgctaggttccggtgtacctggtcaccccgca
gccatcccccacccagccattgtgcccccttcagggaagcaggagctgcagccctatgac
cgcagcctgaagacgcaggcagaatccaaggcagagaaggaagccaagaagccaaccatc
aagaagcctctcaacgccttcatgctgtacatgaaggagatgagagcaaaggtcattgca
gaatgcacactcaaggagagcgctgccatcaaccagatcctgggccgtaggtggcacgca
ctgtcccgggaagagcaagccaagtattatgagctggcccgcaaggagaggcagctgcac
atgcagctctacccaggctggtcggcgcgggacaactacgggaagaagaagaggcggtca
cgggaaaagcaccaagaatccaacacaggaggaaaaagaaatgcattcggtacttacccg
gagaaggccgctgccccagccccgttccttccgatgacagtgctctag

DBGET integrated database retrieval system