KEGG   Delphinapterus leucas (beluga whale): 111165399
Entry
111165399         CDS       T05885                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2
  KO
K05691  catenin alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04670  Leukocyte transendothelial migration
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05213  Endometrial cancer
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111165399 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111165399 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111165399 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165399 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    111165399 (CTNNA2)
   05213 Endometrial cancer
    111165399 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111165399 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111165399 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111165399 (CTNNA2)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111165399 (CTNNA2)
SSDB
Motif
Pfam: Vinculin CorA
Other DBs
NCBI-GeneID: 111165399
NCBI-ProteinID: XP_022411722
UniProt: A0A2Y9LXE7
LinkDB
Position
Unknown
AA seq 865 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLRIELKDPHCRDEMAAARGALKKNATML
YTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAAL
NEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQ
ALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLL
VLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCP
QVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILED
VNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSET
VMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDS
DFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAE
VAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLAR
AVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQA
AKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTR
VRRGSQKKHISPVQALSEFKAMDSF
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcatattaaaatgggaccccaaaagtttggaaatccga
actctaacagtggagagacttttggagccacttgttacacaggtgacgacccttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtactg
gctgcatctgtagagcaagccactcagaactttctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaggaattggttgctgctgttgaggatgtacgcaaacaaggt
gagacgatgcgcatcgcctcttcagagttcgctgatgatccgtgctcctcggtgaagcgt
ggcaccatggtgcgagctgcccgggctctgctatcggctgtaacgcgcttgctcatcctg
gcggacatggcagacgtcatgagacttttatctcatctgagaattgagctgaaggaccct
cattgtcgggatgagatggcagccgcccgaggggctctaaagaagaacgccacaatgctg
tacacagcctcccaagccttcctccgccacccagatgttgccgccacgagagccaaccga
gattacgtgttcaaacaagtgcaggaggccattgccggcatctccaatgctgctcaagct
acctcgcccaccgacgaagccaaaggccacacgggcatcggggagctggctgcggctctg
aacgaatttgacaacaagatcatcctggaccccatgacgttcagcgaggcccggttccgg
ccgtccctagaggagcgcctggaaagcatcatcagcggcgcggctctcatggccgactcc
tcgtgcacacgcgacgaccggcgcgagcggatcgtggccgagtgcaacgccgtgcgccag
gcgctccaggacctgctcagcgagtacatgaacaacactggaagaaaagaaaaaggagat
cctctaaacattgcaattgataagatgaccaagaaaacaagggatctaaggagacagctt
cggaaagcagtgatggatcacatatctgattctttcttggaaaccaacgtccctttgcta
gttctcattgaggctgcaaaaagtgggaatgagaaggaagtgaaggaatacgcccaggtt
ttccgcgagcatgccaacaagctggtggaggttgccaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgccgctctcacactggctgcccggccacagagcaaagttgctcaggac
aatatggatgtcttcaaagaccagtgggaaaagcaggtccgagtgctgacagaggctgtg
gatgacatcacctcagtggatgacttcctttctgtctcagaaaatcatatcttggaggat
gtaaacaagtgtgtgatagcccttcaagagggggatgtggacactctggacaggactgca
ggggctatcaggggccgggcagctcgagtcatacacatcatcaatgctgagatggagaac
tatgaagctggagtttatactgagaaggtgctggaagctacaaaattgctctctgagaca
gtgatgccacgctttgctgaacaagtggaggttgccattgaagccctgagtgccaacgtc
cctcaaccatttgaagagaatgagttcatcgatgcttctcgcctggtatacgacggtgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggacgattca
gactttgagcaagaagattatgatgtacgtagccggacaagtgttcagacagaggatgac
cagctcattgcagggcagagtgcacgggccatcatggcacaactaccgcaagaggagaag
gcaaaaatagctgagcaggtggagatattccaccaagagaaaagcaagctggatgctgaa
gtggccaaatgggacgacagcggcaatgatatcattgtgctggccaagcagatgtgtatg
atcatgatggaaatgacagacttcaccagaggcaaaggcccgttgaaaaatacatcagat
gtgattaatgccgccaagaaaattgccgaagcaggctctcgaatggacaaattagcccga
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcaacttaatatctgcagcaaggtgaaagccgaagtacag
aatctgggaggagagctcattgtgtcagggctggacagtgccacatcgctcatccaggca
gctaaaaatctgatgaatgctgttgtcctcacggtgaaagcatcttatgtggcctcaaca
aaatatcagaaggtctatgggacagcagctgtcaactcacctgttgtgtcttggaagatg
aaggctccagagaagaagccccttgtgaagagagaaaagcctgaagaattccagacacga
gttagacgaggttctcagaagaaacacatttcgcctgtacaggctttaagtgaattcaaa
gcaatggattccttctag

KEGG   Delphinapterus leucas (beluga whale): 111178986
Entry
111178986         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: catenin alpha-1-like
  KO
K05691  catenin alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04670  Leukocyte transendothelial migration
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05213  Endometrial cancer
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111178986
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111178986
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111178986
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178986
  09162 Cancer: specific types
   05226 Gastric cancer
    111178986
   05213 Endometrial cancer
    111178986
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111178986
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111178986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111178986
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111178986
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 111178986
NCBI-ProteinID: XP_022437894
UniProt: A0A2Y9NS58
LinkDB
Position
Unknown
AA seq 908 aa
MTAVHAGNINIKRDPKSLEIRTLAVERLLQPLVTQVTTLVNTNSKGPSNKNXGRSKKAHV
WAASVEQATDNFLEDRDKIAKESQFLKEELVAAVEGVXKQGDLMESAIGEFVDGPSSPTT
RGNAVRAARALLSGVTRLLNLPDVTDAYKLLVQLKVVEDGILKLGNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQERKDMGHRDPMAAARGILQKNVPILYTAPQACLQHADVAACKAS
RDLIYKQLREAVTGVSSAAQATGSDDASQHQGREGGELACALNNFDKQIIVDPLSFSEER
FRPSLEGRLQSIISGAALMADSSCTRDDRRERVVAECNAVRQALQDLLSQYMGNAGRKEG
SDALNSAIDKMTKKTTDLQRQLCKAVMDHVSDSFLETSVPLLVLIEAAKNGNKKEVKEXA
RVFRERADKLTEVINAALALAAKPRSKLAQENMDPFKERWEKQVRGLTDDVNDITSIDDF
LAVSENHILKDVNKCVIALHEKDADGMYRTAGATRGRAARVIHVVTSETDTYEPGVYTEK
VLEATKLLSNTVMPHFTEQXEAAVEALSSDPAQPMEEEEFTDATRLVYDGIRDVRKALLM
IRTPEELGDSDFETEDFDVRSRTSVRTEDDQLMAGQSARATMALLPQEQKAKTAEQVASF
QEEKSKLDAEVSKWVDRGNDIIVLAKQTCMIMMEMKDFTRGKGPLKDTSDVISAAKKIAE
AGSWMGKPGRTVADHCPDSACKRDLLAYLQCIVLYCHQLNTYSKVKADVQNLAGELVVSG
VDSATSLIQXAKNLMNAVVQTVKVSCAASAKYXKSQGRASRNLPAVSWKMKVPEKKPLVK
REAQDETQTKIKRASQKKHVSPVQALSEVKAVDSISGCPHPSGLLKTCQCSSLLCLLNRT
LILDSIGR
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgcaggcaacataaacatcaaacgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttgcagcctcttgttacccaggttacaaccctggtc
aataccaatagcaaggggccctctaataagaattgaggtcgttctaagaaggcccatgtt
tgggctgcatctgtcgaacaagcaacagacaatttcttggaggacagggataaaattgca
aaggagagtcagtttctcaaggaggagcttgtggctgctgtagaaggtgtttgaaaacaa
ggagatttgatggagagtgctattggagagtttgtggatggtccctcttctcccacgacg
cgtggcaacgcggttcgggcagctcgagctttgctctctggtgttacccggctgcttaat
ttgcctgacgtgacagatgcctacaaattacttgttcagctgaaagttgtagaagacggt
atcttgaaactggggaatgctggcactgaacaggacttgggaatacagtataaggccctg
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaacggaaagat
atgggccatcgtgatccgatggctgcagccagaggaatcctgcagaaaaacgttccaatc
ctctatactgcaccccaggcatgcctacagcacgctgatgtcgcagcctgtaaggccagc
agagacctgatatacaagcagctgcgggaggcggtcacaggcgtttctagtgcagcccag
gctactggatcagatgacgcctcccagcaccagggtcgagaaggaggagaactggcatgt
gccctcaataactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggggcgcctgcaaagcatcattagtggggctgccctgatggct
gattcatcctgcacacgtgatgaccggcgtgagagagtcgtggccgagtgtaatgctgtc
cgccaggccttgcaggacctgctctcacagtacatgggcaacgctgggcgtaaagaaggg
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccacggacttgcagagg
cagctctgcaaagctgtcatggaccatgtttcagattcatttctggaaaccagcgttcca
cttttagtattgattgaagctgcaaagaatggaaacaagaaagaagttaaagaanatgcc
cgagttttccgtgaacgtgccgacaaattaactgaggttatcaatgctgcgttggcttta
gcagcaaaaccacggagtaaactggcccaagagaacatggatccttttaaagaacggtgg
gaaaaacaagtccgaggtctcacagatgatgtcaatgacattacttccattgatgacttc
ctggctgtctcagagaatcacattttgaaagacgtgaacaaatgcgtcatcgctctccat
gagaaagatgcggatgggatgtaccgcacagctggtgcaactcgaggccgagctgctcgg
gtcattcacgtggtcacctcagagacggacacctacgagccaggggtctacacagagaag
gttctggaagccaccaaactcctctccaacacagtcatgccacattttaccgagcaangc
gaagcggccgtggaagccctcagctcggacccggcccagcccatggaggaggaggagttt
actgacgccacacgcctggtgtacgacggcatccgggacgtcaggaaagcgctgctgatg
ataaggacccctgaggagctgggtgactcggacttcgagacggaagacttcgatgtcaga
agcaggacaagcgtccggacggaagacgatcagctgatggctggccagagtgcccgggcg
accatggctctccttccccaggagcaaaaagcaaagactgcggaacaggtggccagtttc
caggaagaaaagagcaagctggatgccgaagtgtccaagtgggtcgaccgtggtaatgac
atcatcgtgctggccaagcagacgtgcatgatcatgatggagatgaaggactttacccga
ggtaaaggaccgctcaaagacacatcagatgtgatcagtgccgccaagaaaattgctgag
gcgggatcctggatgggtaagcctggccgtaccgtcgcagaccattgcccagactcagcc
tgcaagagggacctgctggcctacctgcagtgcatcgtcctctactgccaccagctcaac
acctacagcaaagtcaaggctgacgtgcagaacctcgctggggagctggtcgtctccggg
gtggacagcgccacgtccctgatccaangcgctaagaacttgatgaacgcggtggtgcag
acagtgaaggtgtcgtgtgcagcctccgccaaatactagaagtctcaggggagggcttcc
cgtaacctccctgctgtgtcatggaagatgaaggtgcctgagaaaaagcccttggtgaag
agagaggcacaggatgagacacagaccaagattaagagggcatctcagaagaagcacgtg
agccctgtgcaggccctcagtgaggtcaaagccgtggacagcatctcaggctgcccccac
ccctcagggcttctaaagacctgtcagtgttcttcactcttgtgtttgctaaataggaca
ctgatattagattccataggaagatag

KEGG   Delphinapterus leucas (beluga whale): 111182500
Entry
111182500         CDS       T05885                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04670  Leukocyte transendothelial migration
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05213  Endometrial cancer
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111182500 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111182500 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111182500 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182500 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    111182500 (CTNNA1)
   05213 Endometrial cancer
    111182500 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111182500 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111182500 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111182500 (CTNNA1)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111182500 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 111182500
NCBI-ProteinID: XP_022444615
UniProt: A0A2Y9PFF8
LinkDB
Position
Unknown
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDMGHRDQMAAARGILQKNIPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgcaggcaacataaacttcaaatgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttggagcctcttgttacccaggttacaaccctggta
aacaccaatagcaaggggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaggcaactgagaatttcttggagaagggggataaaattgca
aaggagagtcagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagagtgctgccggagagtttgcagatgatccctgctcttccgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttacccggctgcttatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtagaagacggt
atcttgaaactgaggaatgctggcactgaacaggacttgggaatacaatataaggccctg
aaacctgaagtggataagttgaacattatggcagccaaaagacaacaggaactgaaagat
atgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaacattccaatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agagacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgccgcccag
gctactgcgtcagatgatgcctcccagcaccagggtggaggaggaggagaactggcatat
gccctcaataactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgcctggaaagcatcattagtggggctgccctgatggct
gattcatcctgcacacgtgatgaccggcgtgagagaatcgtggcagagtgtaatgctgtc
cgccaggccttgcaggacctgctctcggagtacatgggcaacgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtagg
cagctccgcaaagctgtcatggaccatgtttcagattcatttctggaaaccaacgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaagaatatgcc
caagttttccgtgaacatgccaacaaattaattgaggttgccaacttggcctgttccatc
tcaaacaatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagctagaagccctc
tgtcctcaggttatcaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacagtgggaaaaacaagtccgagttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagacgtgaacaaatgcgtcattgctctccaagagaaagatgtggatgggctggaccgc
acagctggtgcaattcgaggccgagctgctcgggtcattcacgtggtcacctcagagatg
gacaactatgagccaggggtctacacagagaaggtgctggaagccaccaagctcctctcc
aacacagtcatgccacgttttaccgagcaagtggaagcggccgtggaagccctcagctca
gaccccgcccagcccatggatgagaacgagtttatcgatgcctcacgcctggtgtacgat
ggcatccgggacatcaggaaagcggtgttgatgataaggacccctgaggagctggatgac
tcggacttcgagaccgaagacttcgatgtcagaagcaggacaagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaagtgggacgacagtggtaatgacatcatcgtgctggccaagcagatgtgc
atgatcatgatggagatgacggactttacccgaggtaaaggaccgctcaaaaacacatca
gatgtgatcagtgccgccaagaaaattgctgaggcaggatcccggatggataagcttggc
cgtaccatcgcagaccattgcccagactcagcctgcaagcaggacctgctggcctacctg
cagcgcatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggctgaggtg
cagaacctcggtggggagctggtcgtctccggggtggacagtgccatgtccctgatccaa
gctgctaagaacttgatgaacgctgtggtgcagacagtgaaggcgtcctatgtggcctcc
accaaataccagaagtctcaggggatggcttcccttaaccttcctgctgtgtcgtggaag
atgaaggcgcctgagaaaaagcccttggttaagagagagaaacaggatgagacacagacc
aagattaagagggcatctcagaagaagcatgtgaaccctgtgcaggccctcagcgagttc
aaagccatggacagcatctaa

KEGG   Delphinapterus leucas (beluga whale): 111183426
Entry
111183426         CDS       T05885                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04390  Hippo signaling pathway
dle04520  Adherens junction
dle04670  Leukocyte transendothelial migration
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05213  Endometrial cancer
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111183426 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111183426 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111183426 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183426 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    111183426 (CTNNA3)
   05213 Endometrial cancer
    111183426 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111183426 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111183426 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111183426 (CTNNA3)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     111183426 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32
Other DBs
NCBI-GeneID: 111183426
NCBI-ProteinID: XP_022446400
UniProt: A0A2Y9PKV2
LinkDB
Position
Unknown
AA seq 944 aa
MGRLAGGLRTKFCALVSILPTGNDTSIALKEDHPSPLDANLLRLFIKAVMSAETPITLNV
NPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLASVEEATWNLLD
KGEKIAQEATVLKEELTGALEDVRKESEALKVSAERFADDPCYLAKREAVVQAARALLAA
VTRLLILADMIDVMCLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKELENLDYLAFKR
QQDLKSPNQRDEIAGARASLKENSPILHSICSACLEHSDVASLKASKDTVCEEIQNALDV
ISNASQGIQNVLVPPEPQAATLGSALDELENLIVLDPLTVTEEETRPSLEKRLEAIISGA
ALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLNIAIENMCKKTR
DLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFREHTSRLVEVANL
ACSMSTNEDGIKIVKVAANHLETLCPQIINAALALAARPKSQVVKKTMEMYRCTWENHVH
VLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIV
TGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLDVFDDDQFVDISK
KIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSVQTEGKTDRAKMTQLPEAEKE
KIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTRGKGPLKHTTDV
IYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQVKAEIQS
LGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMK
APAKKPLIKREKPEETYAAVRRGSAKKKIHPVQVMSEFRGRHIY
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggggagacttgcaggtggtttgagaacaaagttctgtgcattagtatccatcctccca
acgggtaatgacacttcaattgcacttaaggaggaccacccctcaccactggatgcaaac
ttacttcgcctgtttatcaaggcagtcatgtcagctgaaacaccaatcacactgaatgtc
aatcctcaggatctgcaggtccagacattcaccgtagagaagctgctggagcctctcata
atccaggttactacacttgtaaattgtccccagaatccttccaacaggaaaaaaggacgt
tctaaaagagccagagtccttctagcttctgtggaggaagcaacttggaatttattagac
aagggagagaagattgctcaagaagccacagttttaaaggaagagcttactggggcactt
gaggatgttcgcaaagaaagtgaagctctgaaagtatcagctgagagatttgcagatgat
ccctgttatctcgcaaaaagggaggctgtggttcaagctgcccgtgccttgttggctgca
gttaccagactccttatcctcgcagatatgattgatgtcatgtgtctcttgcagcatgtg
tcagcttttcagaggacatttgagtctcttaaaaatgtttccaacaaatctgacctccag
aaaacctaccagaagcttgggaaggagctggaaaatctggactatttagccttcaaacgt
cagcaggacctaaaatctccaaatcagagggatgaaattgcaggtgcccgggcctcattg
aaggagaactcccccatattgcattcaatttgttcagcttgtttggaacattctgatgtc
gcttccctcaaagccagcaaggacacagtttgtgaagaaattcagaacgccctcgatgta
atttcaaatgcttcacaaggcatccagaatgtgttagtcccaccagaacctcaggcagca
accctgggaagtgcccttgatgagcttgagaatttaattgtcttggatccactcacagtg
actgaggaggaaacaagaccatccctagagaaacgcctcgaagccattatcagtggggct
gctctgttggctgactcttcatgcacgagggatttccatcgggagcgaattatcgcagaa
tgcaatgccattcgccaggctctccaggacctgctttcagagtacatgaacaatactgga
aaaaaggaaaggagtaataccttgaatattgcaatagaaaacatgtgcaagaagacaaga
gaccttcgcagacagctccgtaaggctattatagatcatgtgtcagactcctttttggat
acgacagtcccacttttggttctcattgaagctgccaagaatggccgggaaaaggaaata
aaagaatatgctgcaatatttcgtgaacacaccagcaggcttgtagaggtggcaaatctt
gcttgttccatgtcaacaaatgaagatggaattaagattgtcaaagttgcagccaatcac
ctggaaaccttgtgtccacagattattaatgctgcacttgctttggctgcaagacccaaa
agccaagtggtcaaaaaaaccatggaaatgtacagatgcacgtgggagaatcatgtccat
gtcctcactgaagctgtagatgacattacaagcattgatgacttccttgctgtatctgag
agccatatcctagaagatgtcaacaaatgtatcatagccttgagagaccaggatgctgat
aatttagatcgagctgcaggtgctatcagaggacgggccgcaagagttgctcacattgtc
acaggtgaaatggacagttacgagccgggagcttacacagaaggtgtgatgagaaatgtt
aacttcctgacaagtactgtaattccggaatttgtaacacaagtgaatgttgccttggaa
gccttaagtaaaaactctttggatgtgtttgatgatgatcagtttgtggacatctcaaaa
aagatctatgatacaattcatgatattagatgttcagtcatgatgattcggactccagag
gaactagaggatgtttctgacctggaagaagatcacgaggtccgcagtcacaccagtgtt
cagactgaagggaaaactgatcgggctaagatgactcaattgcctgaggcagaaaaggaa
aagatagctgagcaagttgctgatttcaagaaagtaaagagtaagctggatgctgagatt
gagatatgggacgatacgagcaacgatatcattgttcttgccaagaagatgtgtatgatc
atgatggagatgacagacttcacaaggggaaaaggaccactgaagcatacaactgatgtg
atctatgcagctaaaatgatatcagaatcaggatcaaggatggacgtccttgctcggcag
attgccaaccagtgcccagatccatcatgcaaacaggacttgttggcctacctggaacag
attaaattctactctcaccagctgaaaatctgcagtcaggttaaagctgagatccagagc
ctgggaggagagctcatcatgtcagcattggacagtgtcacctccctgatccaagcagcc
aaaaatttaatgaatgctgtagtgcaaacagtgaaaatgtcttacattgcctcaaccaag
atcatccgaattcagagtcctgctgggccccggcacccagttgttatgtggagaatgaag
gctcctgcaaaaaaacccttgattaaaagagagaaaccagaggaaacttatgcagctgtc
agacgaggctcagcaaagaaaaaaatccacccagtgcaagtgatgagtgaatttagagga
agacatatctactga

DBGET integrated database retrieval system