KEGG   Delphinapterus leucas (beluga whale): 111165537
Entry
111165537         CDS       T05885                                 

Gene name
DDX3X
Definition
(RefSeq) ATP-dependent RNA helicase DDX3X isoform X1
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04622  RIG-I-like receptor signaling pathway
dle05161  Hepatitis B
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    111165537 (DDX3X)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111165537 (DDX3X)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111165537 (DDX3X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111165537 (DDX3X)
   03041 Spliceosome [BR:dle03041]
    111165537 (DDX3X)
   03036 Chromosome and associated proteins [BR:dle03036]
    111165537 (DDX3X)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111165537 (DDX3X)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111165537 (DDX3X)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111165537 (DDX3X)
Spliceosome [BR:dle03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    111165537 (DDX3X)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    111165537 (DDX3X)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 111165537
NCBI-ProteinID: XP_022412031
UniProt: A0A2Y9LTF4
LinkDB
Position
Unknown
AA seq 662 aa
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGCRSDSRGKSSFFSDRGSGSRGRFDDRGRGDYDSIGSRGERGGFGKYE
RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
SFSDLEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNVNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGAR
DYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWW
GN
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcggtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttctgataatcagagtggaggaagtaccgccagcaaagggcgctatattcct
cctcacttaaggaacagagaagctactaaaggattctatgataaagacagttcagggtgg
agttctagtaaagataaggatgcatacagcagttttggttgccgtagtgattcaagaggg
aagtctagtttcttcagtgatcgcggaagtggatcaaggggaaggtttgatgatcgtgga
cgaggtgactatgacagcattggcagccgtggtgaaagaggtggctttggaaaatatgaa
cgtggtggaaacagtcgctggtgtgacaaatcagatgaagatgattggtcaaaaccactc
ccgccaagtgaacgcttggaacaagaacttttttctggaggcaacaccgggattaacttt
gaaaaatacgatgacattccagttgaggcaacaggcaacaactgtcctccacacattgaa
agtttcagtgatcttgagatgggagaaattattatgggaaacattgagcttactcgctac
actcgtccaactccagtgcaaaagcatgctattcctattatcaaagagaagagagacttg
atggcttgtgcccaaacagggtctggaaaaactgcagcatttctcttgcccatcttgagt
cagatttattctgatggtccaggcgaggctttgagggccatgaaggaaaatggaagatat
gggcgccgcaaacaatacccaatctccttggtgttagcaccaactagagaattggctgta
cagatctatgaggaagccaggaaattttcataccgatctagagttcgtccttgcgtggtt
tatggtggtgctgatattggtcagcaaattcgagacttagaacgtggatgtcacttgtta
gtagccactccaggacgtctagtggatatgatggaaagagggaagattggattagacttc
tgcaaatacttggtgttagatgaagctgatcggatgttggatatggggtttgagcctcaa
atacgtagaatcgttgaacaagatactatgccaccaaagggagttcgccacactatgatg
tttagtgctaccttcccgaaggaaatacagatgcttgctcgtgatttcttggatgagtat
atctttctggccgtaggaagagttggctctacctctgagaacatcacacagaaagtagtc
tgggtggaagagtcagacaaacggtcatttctgcttgaccttctaaatgcaacaggcaaa
gattcactgaccttagtgtttgtggagaccaaaaagggtgcagattctctagaggatttc
ttgtaccatgaaggatatgcctgtacaagtatccatggagaccgatctcagagagataga
gaagaggctcttcaccagttccgctcaggaaaaagcccgattctagtggctacagcagta
gcagcaagaggactggacatttcaaatgtgaaacatgttatcaattttgatttgcccagt
gatattgaagaatatgtacatcgcattggccgtacaggacgtgtaggaaaccttggcctt
gccacctcattctttaatgagaggaacgtaaatattaccaaggatttgttggatcttctt
gttgaagctaaacaagaagtgccatcttggttagaaaacatggcttatgaacatcactac
aagggtagcagtcgtggacgatccaaaagtagtagattcagtggaggatttggtgccaga
gactatcgacagagtagtggtgccagcagttccagcttcagcagcagccgcgccagcagc
agccgcagtggtggaggcggccatggcagcagcagagggtttggtggaggtggctatgga
ggcttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtgg
ggtaactga

DBGET integrated database retrieval system