KEGG   Delphinapterus leucas (beluga whale): 111165564
Entry
111165564         CDS       T05885                                 

Gene name
ELK1
Definition
(RefSeq) LOW QUALITY PROTEIN: ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04510  Focal adhesion
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04921  Oxytocin signaling pathway
dle05140  Leishmaniasis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05213  Endometrial cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111165564 (ELK1)
   04012 ErbB signaling pathway
    111165564 (ELK1)
   04014 Ras signaling pathway
    111165564 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165564 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111165564 (ELK1)
   04912 GnRH signaling pathway
    111165564 (ELK1)
   04921 Oxytocin signaling pathway
    111165564 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165564 (ELK1)
   05205 Proteoglycans in cancer
    111165564 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111165564 (ELK1)
   05213 Endometrial cancer
    111165564 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111165564 (ELK1)
   05161 Hepatitis B
    111165564 (ELK1)
   05163 Human cytomegalovirus infection
    111165564 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111165564 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111165564 (ELK1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    111165564 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 111165564
NCBI-ProteinID: XP_022412111
UniProt: A0A2Y9LTR6
LinkDB
Position
Unknown
AA seq 442 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCLPQPEVSVTSTVANVGTTAVH
AIPGDTASGKPGTPRGAGVAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPQPPXSSSAF
HSAPQHRPCRSSSAPLGGQEHQSSPLEACLEAEEAGLPLQVILTPPEAPNLKSEEPNMEP
GLGRPLPPEVKVEEPKEELEAAATGEAGFVLEAVKAEPFEPKAEPEAPPAEGVPARLPAV
VMETAAPVGGLAASTTSSTENTQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQ
APGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVH
IPSISVDGLSTPVVLSPGPQKP
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacgctgtggcagtttctgctgcagctgttgagagagcaaggcaat
ggccacattatctcctggacctcccgggatggcggtgagttcaagctggtggatgctgag
gaggtggcccggctctgggggctgcgcaagaataagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgataagaacatcatccgcaaagtgagtggccagaag
ttcgtctacaagtttgtgtcctaccccgaggtcgcggggtgctctactgaggactgcctg
ccccagcctgaggtgtctgtcacctccactgtggcaaatgtgggcaccacagctgtacac
gccatccccggggacactgcctctgggaagccaggcacacccaggggtgcaggagtggca
ggcccaggcggcttggcacgcagcagccggaatgattacatgcgctcgggcctctattcc
accttcaccatccagtccctgcagccgcagccacagccacccntctcatcctcggccttc
cacagtgctccccaacaccgcccctgcaggagcagcagtgcccccctcggggggcaggag
caccagtccagccccttggaggcctgcctggaggctgaggaggccggcctgcctctccag
gtcatcctgaccccacccgaggccccaaaccttaaatccgaagagccaaatatggagcct
ggattgggccgaccactgcccccagaagtcaaagtggaagagcccaaggaagagttagaa
gctgcagccactggggaggcggggtttgtcctggaagccgtcaaggccgagccctttgag
cccaaggccgagccagaagcccctcccgcggagggcgtgccagcccggctgcctgcggtc
gttatggaaactgcggcgccggtgggcggccttgcggcttccacaacttccagcacggag
aacacccagcctcagaagggccggaagccccgggacctggagcttccactcagcccgagc
ttgctgggtgggccgggacccgaacggactccaggatcgggaactggttccggtctgcag
gcgccaggcccagcgctgacgccttccctgctacctacgcacacattgaccccggtgctg
ctgacgcccagctcgctgccccccagcattcatttctggagcaccctgagtcccattgca
ccccgtagcccggccaagctctccttccagtttccgtccagtggcagcgcccaggtgcac
atcccttccatcagcgtggatggcctctcaacccccgtggtgctctccccagggccccag
aagccatga

DBGET integrated database retrieval system