KEGG   Delphinapterus leucas (beluga whale): 111165611
Entry
111165611         CDS       T05885                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05170  Human immunodeficiency virus 1 infection
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111165611 (PAK5)
   04014 Ras signaling pathway
    111165611 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165611 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111165611 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111165611 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    111165611 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111165611 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111165611 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111165611 (PAK5)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111165611 (PAK5)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111165611 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 111165611
NCBI-ProteinID: XP_022412160
UniProt: A0A2Y9LS24
LinkDB
Position
Unknown
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGQGHR
EENGFLTFSQYSSESDTTADYAMEKYKEKSLYGDDLDPFYKGSHSAKQNGHVMKMQHGEA
YYSEMKPLQSNRARFPVDYHTHLDSLSKPSEYSDLKWGYQRASSSSPLDYPFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLSQTSPQPAMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYSSYTYPRLSEPTMCIPKVDYDRAQVVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPSGYHTATLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVNDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttggaaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcatactgggtttgatccacaagaacagaaatttaccggccttccccagcagtggcac
agcctgttagcagacacggccaacaggccgaagcccatggtagacccttcgtgcatcact
cccatccagctggctcccatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaatggccttctggaggatttcgacaacatctctgtgacccgctccaactcccta
aggaaggaaagcccgcccaccccagaccagggagcctccagccatggtcaaggccatcgg
gaagaaaatggattcctcaccttctcacagtattccagcgaatctgataccactgctgac
tatgcgatggaaaagtacaaagaaaagagtctctatggagatgatttggacccgttttat
aaaggcagccactcggccaagcaaaatgggcacgtaatgaaaatgcaacatggggaagcc
tactactctgagatgaagcctttgcaatccaacagagccaggtttcctgttgattatcac
acacacttggactcactgagcaaacccagtgagtacagtgacctcaaatgggggtaccag
cgagcctcaagcagctcccctctggattatccattccaattcacgccttctagaactgca
gggaccagtgggtgctccaaggagagcctggcgtacagcgaaagtgagtggggacccagc
ctggatgactatgacaggaggccaaagtcatcatacctgagtcagacaagccctcagccc
gccatgcggcagaggtcacggtcaggctccgggctccaggaacccatgatgcccttcgga
gcaagtgcatttaaaacccaccctcaaggacactcctacagctcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattatgatcgagcacaggtggtcctc
agccctccactgtcagggtccgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaagcaggctattcctcaagcagccaccagtacccatctgggtaccacacagcc
accctgtaccaccacccctccctccagaccagttcgcagtacatctccacagcttcttac
ctgagctctctcagcatctcatctagcacctaccccccacccagctggggctcctcctca
gaccagcagccctccagggtgtcccacgaacagttccgggcagccctgcagctggtggtc
agcccaggagaccccagagaatatttggacaactttatcaaaatcggggaagggtcaacc
ggcattgtgtgcatcgccactgagaaacacacggggaagcaagtcgccgtgaagaaaatg
gacctccgaaaacaacagagacgagagctgctttttaatgaggttgtgataatgcgggat
tatcaccatgacaatgtggttgacatgtacagcagctaccttgtcaatgatgagctctgg
gttgtcatggaatttctagaaggtggtgccttgacagacatcgttactcataccagaatg
aatgaagaacaaatagctactgtctgtctgtcagttctaagggctctttcctacctgcac
aaccaaggagtgattcacagggacataaagagtgactccatcctgctgacaagtgatggc
cggataaagttgtctgactttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aaatcactggttggcacaccctactggatggcacctgaggtgatttctaggctgccttat
gggacagaggtggacatctggtctctcgggatcatggtgatagagatgattgatggcgag
cccccctacttcaatgagcctcccctccaggccatgcggcggatccgagacagtttacct
ccaagagtgaaggacctgcacaaggtttcttcagtgctccggggattcctagacctgatg
ttggtgagggaaccctctcaaagagccacagcccaggaactcctcggacatccattcttg
aaattggcaggtccgccatcttgcattgttcccctcatgagacaatacaggcatcactga

KEGG   Delphinapterus leucas (beluga whale): 111165746
Entry
111165746         CDS       T05885                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05132  Salmonella infection
dle05170  Human immunodeficiency virus 1 infection
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111165746 (PAK3)
   04014 Ras signaling pathway
    111165746 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111165746 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111165746 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111165746 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    111165746 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111165746 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111165746 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111165746 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111165746 (PAK3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111165746 (PAK3)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111165746 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 111165746
NCBI-ProteinID: XP_022412377
UniProt: A0A2Y9M4U0
LinkDB
Position
Unknown
AA seq 559 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaagcccccagctcccccactgaggatgaacagt
aacaaccgggattcttcggcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagaacgcccagagatctctcttccttcagactttgaacatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattcctgagcaatgggcacgattactccaaacctcc
aacataacaaagctggaacagaagaagaacccccaagccgttctagacgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaagtacatgagctttacgtccggagataaa
agcgcacatggatacatagcagcccatccttcgagtacaaaaacagcatcagagcctcct
ttggctccccctgtgtctgaagaagaagatgaagaagaggaagaagaagaagacgacaat
gagccgccaccagtcattgcaccaagaccagagcatacaaaatcaatctacactcgttcc
gtggttgaatccattgcttcaccagcagcaccaaataaagaggtcacaccaccttctgct
gagaacgccaattccagtactttgtatagaaacacagatcggcaaaggaaaaaatccaag
atgacagatgaggagatcctagagaagctaagaagcattgtgagtgttggtgacccaaag
aaaaaatacacaagatttgaaaaaataggtcaaggggcatcaggtactgtttatacagcg
ctagacatcgccacaggacaagaggtggccataaagcagatgaaccttcaacagcaaccc
aaaaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccccaatatt
gttaattatttagatagctacttagtgggtgatgaactatgggtggtcatggaatacttg
gctggtggctctttgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gccgtctgcagagagtgcctccaagctttggatttcttgcactcaaaccaagtgatccac
agagacataaagagtgacaatattctccttgggatggatggctctgttaaattgactgat
tttgggttctgtgcccagatcacccctgagcaaagtaaacgaagcactatggtgggaact
ccctattggatggcacctgaggtggtgactcgaaaagcttatggtccaaaagttgatatc
tggtctctggggattatggcgattgaaatggtagaaggtgaacccccttaccttaatgaa
aatccactcagggcattatatctgatagccactaatggaaccccagagctccagaatcct
gagagactgtctgctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttacagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcgattaagaacagcagccgctag

KEGG   Delphinapterus leucas (beluga whale): 111172258
Entry
111172258         CDS       T05885                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2 isoform X1
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05170  Human immunodeficiency virus 1 infection
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111172258 (PAK2)
   04012 ErbB signaling pathway
    111172258 (PAK2)
   04014 Ras signaling pathway
    111172258 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111172258 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111172258 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111172258 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    111172258 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111172258 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111172258 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111172258 (PAK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111172258 (PAK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111172258 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 111172258
NCBI-ProteinID: XP_022424341
UniProt: A0A2Y9MTT2
LinkDB
Position
Unknown
AA seq 523 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETAVVTEEDDDDEETPPP
VIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKTSDKQKKKAKMTDEEIMEKLRTIVS
IGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKEL
KNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHA
NQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYG
PKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCL
EMDVEKRGSARELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcaccccctgtgcgaatgagcagt
accatttttagcactggaggcaaagaccctttgtcagccaatcacagtttaaaacctttg
ccctctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaagcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggtgaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctatgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggcttcccatctggaacaccagcactgaataccaag
ggttcggaaacagcagtagtaacagaagaagacgatgatgatgaagagactcctcctcct
gttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaattgatcct
attcctgcaccagttggtgattctaatgttgatagtggtgccaagacttcagacaaacag
aaaaagaaggccaaaatgacagatgaagagattatggagaaattaagaactattgtaagc
ataggtgaccctaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttctggc
acagttttcactgctactgatgtggcattgggacaagaggttgctattaagcagattaat
ttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaatta
aagaatcccaacatagttaacttcttagacagttacttggtgggagacgaattgtttgtg
gtaatggagtacctcgctgggggatcacttactgatgttgtaacagagacctgcatggat
gaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacatgct
aatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggcatggaaggatct
gttaaacttactgactttggcttctgtgcccagatcacccctgagcagagcaagcgaagt
actatggttggaacgccatactggatggcaccagaggtggttacacggaaagcttatggc
cctaaggttgacatctggtctctgggtattatggctattgagatggtagaaggagagcct
ccatatctcaatgaaaatcctttgagggccttgtacctgatagcaactaatggaactcca
gaacttcaaaacccagagaaactttcccccatatttcgggatttcttaaatcgatgtttg
gagatggatgtggagaaaaggggttcagccagagaattgttacagcatcccttcctgaaa
ctggccaaaccattatccagcttgacaccactgatcatggcagctaaagaagcaatgaag
agtaaccgttaa

KEGG   Delphinapterus leucas (beluga whale): 111180877
Entry
111180877         CDS       T05885                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05170  Human immunodeficiency virus 1 infection
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111180877 (PAK4)
   04014 Ras signaling pathway
    111180877 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111180877 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111180877 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111180877 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    111180877 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111180877 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111180877 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111180877 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111180877 (PAK4)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111180877 (PAK4)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111180877 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 111180877
NCBI-ProteinID: XP_022441408
UniProt: A0A2Y9PFK0
LinkDB
Position
Unknown
AA seq 594 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPVE
QAATARGGPEKAGGQGWVAGRSEAGGSSGDRRRVGPDKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPHQPAGLASGAKVAAGRPFNTYPRADTDHPSRGAQGEPHNVAPNGPSVGGLAV
PQSSSASRPPARAHGPPSPGVLGPHASEPQLAPPARTLAAPPAPPAPGPPGPRSPQREPQ
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGRLVAVKKMDLRKQ
QRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQI
AAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVG
TPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKN
LHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgtttgggaagaagaagaagcgggttgagatctcggcaccgtctaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcagctcgccggcccaagcccctcatcgaccccgcctgcatcacc
tccatccagcctggggcccccaagaccatcgtgcggggcagcaaaggcgccaaggatggg
gccctcacgctgctgctcgacgagtttgagaacatgtcggtgacgcgctccaactccctg
cggagagacagcccgccgccacccgcccgtgcccgccaggaaaacgggatgcccgtggag
caggccgccacggccagagggggcccagagaaggcgggcggtcaaggctgggtcgccggt
cgcagcgaggcgggtggcagcagtggagacaggcggcgggtggggccggacaagaggccc
aagtcttccagggagggctcaggggggccccaggagtcctcccgggacaagcgccccctc
tctgggcctgacgtcggcaccccccaccagcctgccggtctggccagcggggcgaaagtg
gcagctggccggccctttaacacgtacccgcgggccgacacggaccacccatcccggggc
gcccagggggagcctcacaacgtggcccccaatgggccatcggtggggggcctggccgtc
ccccagtcctcctctgcctcccggccccccgctcgagcccacggcccccccagccctgga
gtgctgggcccccacgcctccgagccccagctggcccctccagcccgcaccctcgccgcc
ccccctgcaccccccgcccctggaccccccggaccccgctcgccacagcgggaaccccag
cgagtgtcccacgagcagttccgggctgccctgcaactggtggtggaccccggcgaccct
cgctcctatctggacaacttcattaagatcggcgagggctccacgggcatcgtgtgcatt
gccaccgtgcgcagctcgggcaggctggtggccgtcaagaagatggacctgcgcaagcag
cagaggcgcgagctgctcttcaatgaggtggtgatcatgagggactaccagcatgagaac
gtggtggagatgtacaacagctacctggtcggggacgagctctgggtggtgatggagttc
ctggagggaggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatc
gccgccgtgtgcctggccgtgctgcaggccttgtccgtgctccacgcccagggggtcatc
caccgggacatcaagagcgactccatcttgctgacccacgatggcagggtgaagctgtcg
gactttgggttctgtgcccaggtgagcaaggaggtgccccggaggaagtccctggtcggc
acgccctactggatggccccggagctcatctcccgcctcccctacgggccagaggtggac
atctggtctctgggggtgatggtgatcgagatggtggatggggagcccccctacttcaat
gagccacccctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaac
ctgcacaaggtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgtgacccg
gcacagcgggccacggcggctgagctgctcaagcacccattcctggccaaagcgggcccg
cccgccagcatcgtgcccctcatgcgccagaaccgcaccagatga

KEGG   Delphinapterus leucas (beluga whale): 111181755
Entry
111181755         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04660  T cell receptor signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05170  Human immunodeficiency virus 1 infection
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111181755
   04014 Ras signaling pathway
    111181755
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111181755
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111181755
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111181755
  09158 Development and regeneration
   04360 Axon guidance
    111181755
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111181755
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111181755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111181755
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111181755
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111181755
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 111181755
NCBI-ProteinID: XP_030618710
LinkDB
Position
Unknown
AA seq 675 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAAPMDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
QWAANSDMYLQSPQSEHRDPHGLYLSCNGAAPAGRRHMPWPEPQSPRVLPSGLATKAQSL
GPTEFQGAPQRCLQSSPTGTSASTAAGRRGPKIAGHGSEEARPQSCLVGSAAGRPGGEGS
PSPKTPESSLKRRLFRSMFLSAPAAAPPSSSKPGPPPQSKPNASFRPLQKDRPPSLVAKA
QSLPSDQPVGTFSPLATLDTSSPQKSLRTAPAAGPPPGRSSPAGSPRTRHAQISTSNLYL
PQDPAVAKGALAGEETGVVTHEQFKAALRMVVDQGDPRLLLDSYMKIGEGSTGIVCLARE
KHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWVLMEFLQG
GALTDIISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFG
FCAQISKDVPKRKSLVGTPYWMAPEVICRCLYATEVDIWSLGIMVIEMVDGEPPYFSDSP
VQAMKRLRDSPPPKLKNSHKVSPVLRDFLEQMLVRDPQERATAQELLDHPFLLQTGLPEC
LVPLIQLYRKQTSTC
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaaaaagaaacgccctgagatctcggccccacagaatttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagttcgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgacccaagcccgtggtggacccttcacgcatcacc
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcggcgcccatggacggc
tacatctcggggctgctcaacgatatccagaagttgtcagtcatcagctccaacaccctg
cgcggccgcagccccaccagccggcggcgggcacagtccctggggctgctaggggatgag
cagtgggccgccaactcggacatgtacttgcagagcccccagtctgagcacagggacccc
catggcctctacctcagctgcaacggggccgcaccagcagggcgcaggcatatgccatgg
cccgagccacagagcccgcgggtcctgcccagtgggctggccaccaaggcacagtccctg
ggccccaccgagttccagggtgccccgcagcgctgcctgcagagctccccaaccggcacc
tcggcctccacggctgcgggcaggcgggggcccaagattgccgggcatggctctgaggag
gcccggccacagtcctgcctggtgggctcggctgcaggcaggccggggggggagggcagc
cccagccctaagaccccggagagcagcctgaagcgcaggctgttccgaagcatgttcctg
tctgctcctgccgccgcccctccaagcagcagcaagccaggccctccaccacagagcaag
cccaacgcctctttcagaccactgcagaaagaccgccccccaagcctggtggctaaggcc
cagtccttgccctcagaccagcccgtggggaccttcagccctctggccaccttggatacc
agcagcccccagaagtccctccgcacagccccagctgccggccctcctccaggacggtct
tccccggcaggctccccccgcacccggcatgcccagatcagcaccagcaacctgtacctg
ccccaggaccccgcagtggccaagggtgccctggctggtgaggaaacgggcgttgtgaca
cacgagcagttcaaggctgcactcaggatggtggtggaccagggtgacccccggctactg
ctggacagctacatgaagattggcgagggctccacaggcatcgtctgcctggcccgggag
aagcactcgggccgccaggtggccgtcaagatgatggacctcaggaagcagcagcgcagg
gagctgctctttaatgaggtggtgatcatgcgggactaccagcacctcaacgtggtggag
atgtacaagagctacctggtgggcgaggagctgtgggtgcttatggagttcctgcagggc
ggggccctcacggacatcatctcccaagtcaggctgaatgaggagcagattgccaccgtg
tgcgaggccgtgctgcaggccctggcttacctgcacgcccagggtgtcatccaccgggac
atcaagagcgactccatcctgctgaccctcgatggcagggtgaaactctcggacttcgga
ttctgtgcacagatcagcaaagatgtccctaagaggaagtccctggtgggaaccccctac
tggatggctcccgaagtgatctgcaggtgtctgtatgcgactgaggtggatatctggtct
ctgggcatcatggtgattgagatggtagatggagagccaccctacttcagtgactcccca
gtgcaagccatgaagaggctccgggacagccccccacccaagctgaagaactctcacaag
gtctccccagtgctgcgagacttcctggaacagatgctggtgcgagacccccaggagaga
gccacggcccaggaactcctggaccaccccttcctgctgcagacggggctgcccgagtgc
ctggtgcccttgatccagctctaccgcaagcagacctccacctgctga

KEGG   Delphinapterus leucas (beluga whale): 111184900
Entry
111184900         CDS       T05885                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04360  Axon guidance
dle04392  Hippo signaling pathway - multiple species
dle04510  Focal adhesion
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04810  Regulation of actin cytoskeleton
dle05132  Salmonella infection
dle05170  Human immunodeficiency virus 1 infection
dle05205  Proteoglycans in cancer
dle05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111184900 (PAK1)
   04012 ErbB signaling pathway
    111184900 (PAK1)
   04014 Ras signaling pathway
    111184900 (PAK1)
   04392 Hippo signaling pathway - multiple species
    111184900 (PAK1)
   04024 cAMP signaling pathway
    111184900 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111184900 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111184900 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111184900 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    111184900 (PAK1)
   04660 T cell receptor signaling pathway
    111184900 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    111184900 (PAK1)
   04062 Chemokine signaling pathway
    111184900 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    111184900 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111184900 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111184900 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111184900 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111184900 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111184900 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111184900 (PAK1)
   03036 Chromosome and associated proteins [BR:dle03036]
    111184900 (PAK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111184900 (PAK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE20 family
   111184900 (PAK1)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111184900 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    111184900 (PAK1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111184900 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 111184900
NCBI-ProteinID: XP_022449604
UniProt: A0A2Y9PVS7
LinkDB
Position
Unknown
AA seq 543 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRAILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVLPVSEDEDDD
DATPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVATSPISPTENNTTPPDALTRNTEKQ
KKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALEFLHSSQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK
NNH
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgtcgaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagctggcagcaaagatgctggaaccctaaaccacggttccaaacct
ctgcctccaaaccccgaggagaagaaaaagaaggaccgattttaccgagccatcttacct
ggtgataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttcagat
tttgagcacacgattcacgttggttttgatgctgtcacaggcgagtttacagggatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcaccaagtcggagcagaagaaaaac
ccgcaggctgtcctggatgtattagaattttataactcgaagaagacctccaacagccag
aagtacatgagctttacagataaatcagctgaggattataattcttctaacactttgaac
gtgaagacggtgtctgagacccctgcagtgctaccagtttcagaagatgaagatgatgat
gatgctaccccacctccagtgattgctccacgcccagagcacacaaaatctgtatacaca
cggtccgtgattgaaccacttcctattactccaactcgggatgtggctacatctcccatt
tcacctactgagaataataccactccgccagatgctctgacccggaatactgagaagcag
aagaagaagcctaaaatgtctgatgaggagatcttggagaaattacggagcatagtgagt
gtgggtgatcctaagaagaaatatacacggtttgagaagattggacaaggtgcttcaggc
actgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcagatgaac
cttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaaaac
aagaacccaaatattgtgaactacttggacagttacctcgtgggagatgagctgtgggtt
gtcatggaatatttggctggaggttctttgacagacgtggtaacagaaacctgcatggat
gaaggccagattgcagctgtgtgccgtgagtgcctgcaggctttggagtttctgcattcg
agccaagttattcatagagacatcaagagtgacaacatcctgttgggaatggatggctct
gtcaagctaactgactttggattctgtgcccagatcaccccagagcagagcaaacggagc
actatggtgggaacaccgtactggatggcaccagaggttgtgacacggaaggcctacggg
cctaaggttgacatttggtccctgggcatcatggccatcgaaatggttgaaggggagccc
ccataccttaatgaaaatcctctgagagccttgtacctcatcgccaccaatgggaccccg
gagcttcagaacccagagaagctgtcagctatcttccgagactttctgaaccgctgtctt
gaaatggatgtggagaagagaggttcagctaaagagctgttgcagcatcagttcctgaag
attgccaagcccctctccagcctcactccactgattgcggcagcaaaggaggcaaccaag
aacaatcactaa

DBGET integrated database retrieval system