KEGG   Delphinapterus leucas (beluga whale): 111165627
Entry
111165627         CDS       T05885                                 

Gene name
PCNA
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03030  DNA replication
dle03410  Base excision repair
dle03420  Nucleotide excision repair
dle03430  Mismatch repair
dle04110  Cell cycle
dle04530  Tight junction
dle05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111165627 (PCNA)
   03410 Base excision repair
    111165627 (PCNA)
   03420 Nucleotide excision repair
    111165627 (PCNA)
   03430 Mismatch repair
    111165627 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111165627 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111165627 (PCNA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111165627 (PCNA)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    111165627 (PCNA)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111165627 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     111165627 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    111165627 (PCNA)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 111165627
NCBI-ProteinID: XP_022412201
UniProt: A0A2Y9LU04
LinkDB
Position
Unknown
AA seq 261 aa
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIDMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgttcgaggcgcgcctggtccagggctccatcttgaagaaggtgcttgaggcgcttaag
gacctcatcaacgaggcctgctgggacatcagctcgagcggcgtgaacctgcagagcatg
gactcgtcccatgtctctttggtgcagctcaccctgcgctccgagggcttcgacacgtac
cgctgcgaccgcaacttggccatgggcgtgaacctcaccagcatgtccaaaatactgaaa
tgtgctggcaatgaagacatcattacactaagggctgaagataatgcggacaccttggca
cttgtatttgaagctccaaatcaagaaaaggtttcagactatgaaatgaagttaatggat
ttagatgttgaacaacttggaattccagaacaagagtacagctgtgtagtaaagatgcct
tctggtgaatttgcacgtatatgccgagatctcagtcatattggagatgctgttgtaatt
tcctgtgcaaaagatggagtgaaattttctgcaagtggagaacttggaaatggaaatatt
aagttgtcacaaacgagtaatgttgataaagaagaggaggctgttaccatagacatgaat
gaaccagttcagctaacttttgcactgaggtacctgaacttctttacaaaagccactcca
ctctctcctacagtaacactcagtatgtctgcagatgtaccccttgtcgtagagtataaa
attgctgatatgggacatttaaagtactatttggctcccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system