KEGG   Delphinapterus leucas (beluga whale): 111165669
Entry
111165669         CDS       T05885                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04020  Calcium signaling pathway
dle04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111165669 (CACNA1E)
   04020 Calcium signaling pathway
    111165669 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111165669 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111165669 (CACNA1E)
Ion channels [BR:dle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111165669 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 111165669
NCBI-ProteinID: XP_022412251
UniProt: A0A2Y9LU51
LinkDB
Position
Unknown
AA seq 2583 aa
MEERFCLANPWSVLRTLQSDLFQVYVKLRTHQCCGYADMLYTLFQRGSCTVGGITLFHQG
SRASEANGQDPGAAVRSTGGTLGGAAPTHKRGRCSRVEVARGSLRRMWTTSSSSWRAQQL
AREQCSVMVPDMRGLSPGRRLLEPALCPAAGGSPEPGAEGRRRHRHVLALPEEEAWRPQQ
CALLEAEASDEAGMLPASPRASAAGFDNFFPVQEGEGPGWEGGSSPFLPVSPEVMKRRRG
GLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVP
ASGPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPF
EYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFH
KGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVL
KSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQ
GCPAGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYF
IPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAE
EVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTK
VDGASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYA
EFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVL
RALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNF
NDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGN
YTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRR
RRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMPSQEALNKEEAPPMNPLNPL
NPLSSLHPLNAHPSLYRRPRPIEGPALGLGLEKCEEERVSRGGSLQGDGGDLSSALDNQR
SPVSLGKREPPWLARPCHGNCDPTQQEAGGGETVVAFEDRPRHRQSQRRSRHRRVRTEGK
ESSSASRSRSASQERSLDEAVPGEGERDLEPRDSHGGKEPTIQEEERSQDLRRTNSLMMH
RRSGLAGALDEANTPLALPQPELQAEKDAALTEQEPEGSSEQALLGDVQLDMGRVISQSE
PDLSCATANTDKAAPESTSVAVAIPDVGPLVDSTVVHISSKTDGEASPLKEAEIKEDEEE
VEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIAL
AAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVV
VGALVAFALANALGSNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVF
NILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKR
HEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVF
PFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYR
VWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKII
AFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQG
YTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFF
GSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYFVSFIFFC
SFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIPYKDMYKLVRV
ISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQ
LDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQL
EEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLGGRSGYPSMSPLSPQEIFQLA
CMDPADDGQFQEQQSLEPEVSELKSVQPSNHGIYIPSDTQEHAGSGRASSMPRLTVDPQV
VTDPSSMRRSFSTIREKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSG
HKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHQSRSPSECRSQTP
NRPGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHTGSISPPADGSE
GGSPLTSQALEGNDASLPESCDPRYVQQGHPSSPQRYISEPYLALHEDSHASDCGEEETL
TFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRHGGPGPGMTCGAVSDLLSDTEED
DKC
NT seq 7752 nt   +upstreamnt  +downstreamnt
atggaagagaggttctgcttggccaatccctggagtgtcttgcgcacccttcaatctgac
ctcttccaggtttatgtgaaactgaggactcaccagtgctgtggatatgctgatatgctg
tataccctgttccaaagaggcagttgcacagtggggggaatcacgctcttccatcaaggt
tcccgggccagcgaggcaaacggccaggaccctggggccgcggtgaggtccaccggcgga
accttgggaggtgccgctcctacccacaaacggggacggtgttctcgagtggaagtcgcc
cgtggaagtctgaggaggatgtggactacatccagctcatcttggcgtgcccagcagctg
gcacgtgagcaatgttctgtgatggtgcccgacatgcgtggactgagccccggccgcagg
ctgctggagcccgccctctgcccggctgcgggcgggagccctgagcccggggccgagggc
cgccgccgccaccgccacgtcctggccctgcccgaggaggaggcatggcggccccagcag
tgcgccctgctcgaggccgaagcctcggacgaggcgggtatgctgccggcctccccgcgc
gcctccgccgccggcttcgacaacttcttcccggtgcaggagggcgagggcccaggctgg
gagggcggctccagccccttcctcccggtgagccccgaggtgatgaagcggcggcgcggg
ggtcttatcgagcagcgcgacatcatcaaggcccacgaggcgcacaagatgcaaagcacc
ccgcaggcgcggcgcaaggagtgggagatggctcgcttcggggaggcggtggtcggcagg
ccggggtcgggagatggagattcggaccagagcaggaaccggcaaggaacccccgtaccg
gcctccgggccggcggccgcctacaagcagtcgaaagcgcagagggcgcggactatggct
ttgtacaaccccattcccgtccgacagaactgtttcaccgtcaacagatccctgttcatc
ttcggagaagataacattgtcaggaaatacgccaagaagctcatcgattggccgccgttt
gagtacatgatcttggccaccatcattgccaactgcatcgtcttggccctggagcagcat
cttcctgaggatgacaagaccccaatgtcccgcagactggagaagacagaaccgtatttc
atcgggatcttttgctttgaagctgggatcaaaatcgttgccctggggttcatcttccat
aagggctcgtacctccgcaatggctggaatgtcatggacttcatcgtggtcctcagtggc
atcctggccactgcgggaacccacttcaacacacatgtggacttgaggacgctccgggct
gtgcgtgtcctaaggcccctgaagctcgtgtcggggatacctagcctgcagattgtgttg
aagtccatcatgaaggccatggtgcctcttctgcagattggccttctgctcttctttgcc
atcctgatgtttgcgatcattggcttggagttctacagtgggaagttgcaccgagcttgc
ttcatgaacaattcaggtattctagaaggatttgacccccctcacccatgtggtgtgcag
ggctgcccagctggttatgaatgccgggactggatcggccccaatgatgggatcacccag
tttgataacatcctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtgg
accaccgtgctgtacaataccaatgatgccttaggagcaacctggaattggctgtacttc
atccccctgatcatcattggatccttctttgttctcaacctcgtcctgggagtgctttct
ggggaatttgccaaagagagagagagagtggagaaccggagagctttcatgaaactgcgg
cgccagcagcagatcgagcgtgagctgaatgggtaccgtgcgtggatagacaaagcagag
gaagtcatgctcgctgaagaaaataaaaatgctggaacgtcagccttagaagtgctccga
agggcaaccatcaaaaggagccggacggaggccatgacgcgggactccagtgacgagcac
tgtgtcgacatctcctctgtgggcacacccctcgcccgagccagcatcaagagtacaaag
gtggacggggcctcctatttccggcacaaggagcggcttctgcgtatctctatccgccac
atggttaaatcccaggtgttttattggattgtgctgagccttgtggctctcaacaccgcc
tgtgtggccatcgtccatcacaaccagccccagtggctcacccaccttctctactatgca
gaatttttgtttctgggactcttcctcctggagatgtccctgaagatgtacggcatgggg
cctcgcctttattttcactcttcgttcaactgctttgattttggggtcacagtgggcagc
atctttgaagtggtctgggcgatcttcagacctggtacatcttttggaatcagtgtcttg
cgagctctccggcttctaagaatatttaaaataaccaagtattgggcatccctccggaat
ttggtggtctccttgatgagttccatgaagtcaatcatcagtttgctcttccttctcttc
ctctttatcgttgtctttgctctcctaggaatgcagctgtttggaggcaggttcaacttt
aatgatgggactccttcagcaaactttgacaccttccctgcagccatcatgactgtattc
cagatcctgacgggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggt
ggggtcagctcaggcatgtggtcagctatctatttcattgtgctcaccttgtttggaaac
tacacactgctgaatgtgttcttggccatcgctgtggacaatctggccaatgcccaggag
ctgaccaaggatgaacaggaagaagaggaggccttcaaccagaaacacgcgctgcagaag
gccaaggaggtcagcccgatgtctgcacccaacatgccttccatcgaaagagacagaagg
agaagacaccacatgtcgatgtgggagccacgcagcagccacctgagggagcgaaggcgc
cgacaccacatgtcggtgtgggagcagcgcaccagccagctgagaaggcacatgcagatg
cccagccaggaggccctcaacaaggaggaggccccgcccatgaaccccctcaaccccctc
aaccccctgagctccctccacccactcaatgcccaccccagcctctaccggagacccagg
cccatcgaggggccggccctgggcctgggtctggagaagtgtgaggaggagcgcgtcagc
cgcggggggtccctccagggggacggaggggacctgtcgagtgccctggacaaccagagg
agccctgtgtccctgggcaaacgggagccgccctggctggccaggccctgtcatgggaac
tgtgacccgacccagcaggaggccgggggcggggagaccgtggtggccttcgaggaccgg
cccaggcacaggcagagccagcggcgcagccggcaccgccgcgtcaggacggagggcaag
gagtcctcctccgcttccaggagcaggtccgccagccaggagcggagtctggatgaagct
gtgcccggtgagggggagagggacctcgagcccagggacagccacgggggcaaggagccc
acaatccaggaagaagagcgatcccaggacttaaggaggaccaatagtctgatgatgcac
agacgctccgggctggcaggagccctcgacgaggccaacacacccctcgccctgccccaa
ccagagctgcaggcggagaaggatgcagcgctgacggaacaggaaccggaggggagcagt
gagcaagccctgctgggggacgtgcagctggacatgggccgggtcatcagccagagtgaa
cccgacctctcctgcgccacggccaacacggacaaggctgcccccgagagcaccagcgtc
gccgtcgccatccctgacgtgggccccttggtggactcgacggtggtgcacatcagcagc
aagactgatggagaagccagtcccttgaaagaggcagagatcaaagaggatgaggaggaa
gtggagaagaagcagcagaagaaggagaagcgtgagacgggcaaagccatggtgcctcac
agctcaatgttcatcttcagcaccaccaacccgatccgcagggcctgccactacatcgtg
aacctgcgctactttgagatgtgcatcctcctggtgatcgcagccagcagcatcgccctg
gcggccgaggaccccgtcctgaccaactcggagcgcaacaaagtgctgaggtattttgac
tatgttttcactggcgtcttcacctttgagatggttataaagatgatagaccagggcttg
atcctgcaggatgggtcctacttccgagacctgtggaacatcctcgactttgtggtagtg
gttggtgcattggtggcctttgctctggcgaatgccttgggaagcaacaagggccgggac
atcaagaccatcaagtccctgcgggtactgcgtgtgctgagaccgctaaagaccatcaag
cgcctgcccaagctcaaggctgtcttcgactgtgtggtcacctccttgaaaaatgtcttc
aacatactaattgtctataagctcttcatgttcatctttgctgtcatcgcagttcaactt
ttcaagggcaagttcttctattgcacagacagttccaaggacacagagaaggagtgcata
ggaaactatgtagatcacgagaaaaacaagatggaggtgaaaggccgagaatggaagcgc
catgaattccactatgacaacatcatctgggccctgctgaccctcttcaccgtctccaca
ggggaaggatggcctcaagttttgcagcattctgtcgatgtgacagaggaagaccgaggc
ccgagccgcagcaaccgcatggagatgtccatcttttacgtggtctactttgtggtcttt
cctttcttcttcgtcaacatctttgtggctctcatcatcatcaccttccaggagcaaggg
gacaagatgatggaggagtgcagcctggagaagaatgagagggcgtgcatcgacttcgcc
atcagtgccaaaccactcacccgctacatgccccagaacaggcacaccttccagtaccgc
gtgtggcacttcgtggtgtctccgtcctttgagtacaccatcatggccatgatcgccctg
aacactgtcgtgctcatgatgaagtactactctgctccctgtacctatgaactggccctg
aagtacctgaatatcgccttcaccatggtgttctccctggaatgtgtcctaaagatcatc
gcgtttggcttcttgaactatttccgagacacctggaatatctttgacttcatcacggtg
atcggcagtatcacagaaattattctgacagacagcaagctggtgaacaccagtggcttc
aatatgagctttctgaagctcttccgagccgcccgcctcatcaagcttctgcgtcaaggc
tacaccatccgtattttactttggaccttcgtgcagtcctttaaggccctcccctacgtc
tgccttctgattgccatgcttttcttcatctatgccatcattgggatgcaggtctttgga
aacataaaattagatgaggagagtcacatcaaccggcacaacaacttccggagtttcttt
gggtccctcatgctactcttcaggagtgccacgggtgaggcctggcaggagataatgctg
tcgtgcctcggggagaagggctgtgagcctgacaccaccgcaccctcagggcagagcgag
agcgagcgctgtggcaccgacctggcctacgtgtacttcgtctctttcatcttcttctgt
tccttcttgatgctcaacctgttcgtggccgtcatcatggacaactttgagtacctgact
cgggattcatccatcctggggcctcaccacctggacgagttcgtccgtgtctgggcagag
tatgacagagcggcatgcggcaggatcccgtataaggatatgtacaaattagtgcgggtg
atctcgccacctctgggcctgggagagaactgcccctacagggtggcttgcaagaggtta
gtcctgatgaatatgccagtggctgaggacatgactgtccacttcacatccacgcttatg
gctctgatccggacagctctggacattaaaatcgccaaaggtggtgcggacaggcagcag
ctagactcagagctacagaaggagaccctggccatctggcctcacctgtcccagaagatg
ttagatctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgca
gcaatgatgatcatggactactataaacagagcaaggtgaagaagcagaggcagcagctg
gaggaacagaaaaacgcacccatgttccagcggatggagccgtcatctctgcctcaggag
atcattgctaatgccaaagccctgccttatctccagcaggaccccgtttcaggcctgggt
ggccggagtggatacccttcgatgagtccactctccccgcaggaaatattccagttggcc
tgtatggacccagctgatgatggacaattccaggaacagcaatctctggagccagaggtt
agtgaattaaaaagcgtgcagccctctaaccatggcatctacattccttcggacacccag
gagcatgcgggatctgggagggcatcctctatgccacgcctgactgtggatccccaggtg
gtgacagaccctagctccatgagacgttcattttccactattcgggaaaagcgttcaaat
tcctcttggctggaggaattctccatggagcgaagcagcgaaaacacctacaagtcgcgt
cgccggagttaccactcctccctgaggctgtcagcccaccgcctgaactctgactcaggg
cacaagtctgacacccaccgctcagggggcagagagcggggacgatcgaaagagcgaaag
catcttctctctcccgatgtctcccgctgcaactccgaggagcgagggacccaggccgac
tgggagtccccagaacgtcatcagtcccggtctcccagcgagtgcaggtcgcagaccccc
aacagaccgggcacagggtccctcagtgaaagctccatcccctccgtctccgacaccagc
accccaagacgaagtcgtcggcagctcccacctgtccctccaaagcctcggcccctcctt
tcctacagctccctgatgagacacactgggagcatctccccacctgctgatgggagcgag
ggtggctccccactgacctcccaagctctggagggcaatgacgccagcctgcccgagtct
tgcgacccccggtacgtacagcagggccacccctcctccccacagcgctacatctctgag
ccctacctggccctgcacgaagactcccacgcctcggactgtggcgaggaggagacgctc
acctttgaagcagctgtggcgaccagcctcggccggtccaacaccatcggctcagccccg
cccctgcggcacagctggcagatgcccaatgggcactatcggcggcggaggcacgggggg
cctggaccaggcatgacgtgtggagctgtcagcgaccttctgagcgatacggaggaagac
gacaaatgctag

DBGET integrated database retrieval system