KEGG   Delphinapterus leucas (beluga whale): 111165865
Entry
111165865         CDS       T05885                                 

Gene name
LYN
Definition
(RefSeq) tyrosine-protein kinase Lyn isoform X1
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04062  Chemokine signaling pathway
dle04064  NF-kappa B signaling pathway
dle04611  Platelet activation
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04730  Long-term depression
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111165865 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111165865 (LYN)
   04662 B cell receptor signaling pathway
    111165865 (LYN)
   04664 Fc epsilon RI signaling pathway
    111165865 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    111165865 (LYN)
   04062 Chemokine signaling pathway
    111165865 (LYN)
  09156 Nervous system
   04730 Long-term depression
    111165865 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111165865 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111165865 (LYN)
   05169 Epstein-Barr virus infection
    111165865 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111165865 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111165865 (LYN)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111165865 (LYN)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  SRC family
   111165865 (LYN)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111165865 (LYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 SH3_3
Other DBs
NCBI-GeneID: 111165865
NCBI-ProteinID: XP_022412599
UniProt: A0A2Y9M5F9
LinkDB
Position
Unknown
AA seq 512 aa
MGCIKSKRKDNLKDDGIDLKTQPVRNTDRTIYVRDPTSNKQQRPVADSQLLPGQRFQNKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSEALMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaaaggaaagacaatctgaaagacgatggaatagatttgaag
actcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttgcagactctcagcttttaccaggacagaggtttcaaaataaagat
ccagaggagcaaggagacatcgtggtcgcactgtacccctatgatggcatccacccagac
gacttgtccttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtgg
aaagctaaatccctttcgacaaagagagaaggcttcatccccagcaactatgtagccaaa
gtcaacaccttggaaacggaagagtggtttttcaaggatataaccaggaaagatgcagaa
aggcagcttctggcaccagggaacagcgctggagcttttcttatcagagaaagtgaaaca
ttaaaaggaagttactctctgtctgtcagagattatgaccccgtgcatggtgacgttatt
aagcactacaaaatcagaagcctggacaatgggggttattacatctccccacgaatcact
tttccttgtatcagtgacatgattaagcattaccaaaagcagtcagatggcttgtgcaga
agattggagaaggcatgcattagtcccaaaccacagaagccgtgggacaaagatgcctgg
gagatcccccgggaatccattaagctggtgaagaagctcggcgctgggcagttcggggaa
gtctggatgggttactataacaacagtaccaaagtggctgtaaaaaccctgaagccaggc
acaatgtctgtgcaagcattcctggaagaggccaacctcatgaagaccctgcagcatgac
aagctggtgcggctgtacgccgtggtcaccaaggaggagcccatctacatcatcaccgag
tacatggccaagggcagtttgctggatttcctgaagagtgacgaagggggcaaagtactg
cttccaaagctgatcgacttttctgctcagatcgcggagggaatggcgtacattgagagg
aagaactacatccacagggacctacgagccgctaacgtcctggtctccgaggccctcatg
tgtaaaatcgcagattttggccttgctcgagtgattgaggataacgagtacacagccagg
gaaggtgctaagttccccattaagtggacagctccagaagcaatcaactttggatgtttc
actattaagtctgacgtgtggtcctttggaattctcctgtacgaaatcgtcacctatggg
aaaattccctacccagggagaactaacgccgacgtgatgaccgccctgtcgcagggctac
aggatgccccgcatggagaactgcccggacgagctctacgacatcatgaaaatgtgctgg
aaagaaaaggccgaggagaggcccacgtttgactacctgcagagcgtcctggacgacttc
tacacggccacggagggccagtaccagcagcagccttag

DBGET integrated database retrieval system