KEGG   Delphinapterus leucas (beluga whale): 111165914
Entry
111165914         CDS       T05885                                 

Gene name
TICAM1
Definition
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle05133  Pertussis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111165914 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111165914 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111165914 (TICAM1)
   04621 NOD-like receptor signaling pathway
    111165914 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111165914 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111165914 (TICAM1)
   05133 Pertussis
    111165914 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111165914 (TICAM1)
   05160 Hepatitis C
    111165914 (TICAM1)
   05164 Influenza A
    111165914 (TICAM1)
   05168 Herpes simplex virus 1 infection
    111165914 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111165914 (TICAM1)
   05165 Human papillomavirus infection
    111165914 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111165914 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 111165914
NCBI-ProteinID: XP_022412677
UniProt: A0A2Y9M071
LinkDB
Position
Unknown
AA seq 707 aa
MASTGPSLSGAFDILGAVGQDKLLYLKHKLKTLRPGCRGADLLHALVLLKLGQETEARIS
LEALKADAVAKLVARQWAGVDSTEAPEEPPDVSLAVARVYHLLAEERLCPAPMREEAYRA
AVRAFRSRDDPQLGELQEEARDRCGWDVLRDLEAIQTLHSDLGCLLPSSASPSGTRSDPR
PIEDLSDWSRGHSLRSTGSPASLASNLEISQSPTMALLSSHHSPHGPSKLCDKPRASPVP
EPAPMGCQEPEEMSWPPSVEAARSPVRPNSPAPRLPEVAADACPASLHDPPEAPKTSSHY
SVECTDVPAAPKSLPSPSRNACPVADQTPIQLSEEDTTYPAAQPRPPTPSAPQTSPPFSS
PSTPPKAHPTVSKPGPPPPELESPEQKFYNFVVLHAGADEHIALRVRERLEALGVSDGAT
FCEDFQVPGRGELHCLQDALDHSAFTILLLTSNFDCRLSQHQANQSLMSSLTRHGWQDCV
IPFLPLESSLTQLSPSTSSLLTALVWLDEHSPIFARKVANTFKSQKLRARKAKWRKEQDV
RTLQEHSQLLEGERQQAAAWSAAQSAYFHNYLSYQRQMEKLQVAFGSYMPFETRQPSVLQ
APFGGPGPLGAPPPAFPTRPGHQPPPLPPWLAGMPPPAFPQPPVVFPQPQAFPQPPDFPQ
TSPVHPQSSGLQPLIIHHAHMVQLGLNNHMWNQRGTQAPEDKTPETE
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggccagcacagggccgtcgctttctggcgcctttgacattctaggcgcggtgggccag
gataagctcttgtatcttaagcacaagctgaagaccctgcggccaggctgccggggggcg
gacctcctgcatgccctggtgctcctaaagctgggccaggagaccgaggccaggatctcc
ctggaggcgctgaaggcggacgctgtggcgaagctggtggcccgccagtgggctggtgtg
gacagcactgaggccccagaggagcccccagacgtgtccctggccgttgccagggtgtac
caccttcttgccgaggagaggctgtgtccagcgccaatgcgggaggaggcctaccgcgca
gccgtccgtgctttcaggtccagggacgacccccagctgggggagctccaggaagaggca
cgagaccggtgcggatgggacgtccttagggacctggaggccatccaaactctccactcc
gatctggggtgcctcctgccgtcctcggcatcaccctccgggacccgcagcgatccgcgg
cccatcgaggacctttcggactggagcagagggcattccctgagatccaccggcagcccg
gcctccctggccagcaacttggaaattagccagtcgcccaccatggccctcctcagcagt
caccacagcccccacgggcccagcaagctgtgtgacaagccccgggccagcccggtgccc
gagcctgcccctatgggctgccaggagcccgaggagatgagctggcccccatcagtggag
gctgccaggtccccggtgcggccaaacagcccagcccccaggcttcccgaggtggccgca
gatgcatgccccgccagcctgcacgaccctccggaagctccaaaaaccagcagtcactac
tcggtggagtgcacggatgtgccagcagctcccaaatctctcccctcgccttccagaaac
gcctgccctgtcgcggatcagacgccaatccaactttcagaggaagacaccacttaccca
gcggctcagccacgcccaccgactccatcggccccccaaacgtcccctcccttttcgtct
ccatcgacccctcctaaggctcaccctaccgtctcgaagccggggccccctcctcctgag
ctggagtcgccggagcagaagttctataactttgtggtgctgcacgctggcgccgacgag
cacatcgcgctgcgcgtgcgcgagaggctggaggccctgggcgtgagcgacggcgccacc
ttctgcgaagatttccaggtgccagggcgcggcgagctgcactgcctgcaggacgcctta
gaccactcggccttcaccatcctgttgctcacctccaacttcgactgccggctgagccag
caccaggcgaaccagtcgctaatgagcagcctcacgcggcacgggtggcaggattgcgtg
atccccttcctgcccttggagagttccctgacccagctcagccccagcacgtccagcctg
ctcaccgccctggtgtggctggacgagcactccccgatctttgccaggaaggtggccaac
accttcaagtcccagaagctgcgggcccgcaaggccaagtggaggaaggaacaggatgtc
cggaccctgcaggagcacagccaactcctggagggtgagcggcagcaggcagcggcgtgg
agtgccgcgcagtcagcttacttccataactacctgtcctaccagaggcagatggagaag
ctccaggtagctttcgggagctacatgccatttgagactcggcagccttctgtgcttcag
gcgccctttgggggaccggggcccctcggagccccaccaccagcctttcccacccggccg
ggccatcagccgccgcccctgcctccttggctggcgggcatgcccccaccggctttcccg
cagcccccggtggttttcccgcagccccaggccttcccgcagcccccggacttcccacag
acttcacccgtgcaccctcagagctctgggctgcagcccctcatcatacatcatgcacac
atggtacaactgggactcaacaaccatatgtggaaccagagagggacgcaggcgcccgag
gacaagacgccagaaacggaatga

DBGET integrated database retrieval system