KEGG   Delphinapterus leucas (beluga whale): 111165956
Entry
111165956         CDS       T05885                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk1 isoform X1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111165956
   04151 PI3K-Akt signaling pathway
    111165956
   04150 mTOR signaling pathway
    111165956
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111165956
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111165956
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   111165956
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Kdo PX APH
Other DBs
NCBI-GeneID: 111165956
NCBI-ProteinID: XP_022412802
UniProt: A0A2Y9M0K4
LinkDB
Position
Unknown
AA seq 445 aa
MGEMQGALARARLESLLRPRHKKRAEAQKRSESFLLTGLAFMKQRRMGLNDFIQKIANNS
YACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGK
GSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSF
QTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPE
NILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAV
LYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHVLEGLLQKDRTKRLGAKDDF
MEIKNHVFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPNSIGRSPDSIL
LTASVKEAAEAFLGFSYAPPVDSFL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggggagatgcagggcgcgctggccagggcccggctcgagtccctgctccggccccgg
cacaaaaagagggccgaggcgcagaaacggagcgagtccttcttgctgaccggactggct
ttcatgaaacagagaaggatgggcctgaacgactttattcagaagattgccaataactcg
tatgcatgcaaacaccctgaagttcagtccattttgaaaatctcccaacctcaggagcct
gagctcatgaatgccaacccttctcctccaccaagtccttctcagcaaattaacctgggc
ccatcatccaaccctcatgctaaaccatctgactttcacttcttgaaagtgatcgggaag
ggcagttttggaaaggttctcctggcaagacacaaagccgaagaagcgttctatgcagtc
aaagttttacagaagaaagcgatcctgaaaaagaaggaggaaaagcatattatgtcagag
cggaatgttctcctgaagaacgtgaaacaccctttcctggtgggccttcacttctctttc
cagacggctgacaaactgtactttgtcctagactacattaacggtggagagttgttctac
catctccagagggagcgatgcttcctggaaccacgggctcggttctatgctgctgaaata
gccagtgccttgggttacctgcactctctgaacatcgtttatagagacttaaagccagag
aatattttgctggattcacagggacacattgtccttactgactttggactctgcaaggag
aacattgaacacaatggcacgacatccaccttctgcggcacacccgagtatcttgcacct
gaggtgcttcataagcagccttatgataggaccgtggactggtggtgtctgggggccgtc
ttatatgagatgctctatggcctgcctccattttatagccgaaacacagctgagatgtac
gacaacattctgaacaaacccctccagttgaagccaaatattacaaattctgcaagacac
gtcctggagggcctcctgcagaaggacaggacaaagaggcttggtgccaaggatgacttt
atggagattaagaatcacgtcttcttctccctaattaactgggatgatctcattaataag
aagattactcccccttttaacccaaatgtgagtggacccagcgacctgcggcactttgat
cccgagtttaccgaagagccagtccccaactccattggtcggtcgcccgacagtatcctt
ctcacagccagcgtcaaggaagcggccgaggccttcctgggcttttcctacgcacctccc
gtggactctttcctctga

KEGG   Delphinapterus leucas (beluga whale): 111177220
Entry
111177220         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase Sgk1-like
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111177220
   04151 PI3K-Akt signaling pathway
    111177220
   04150 mTOR signaling pathway
    111177220
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111177220
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111177220
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   111177220
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PX
Other DBs
NCBI-GeneID: 111177220
NCBI-ProteinID: XP_022434465
UniProt: A0A2Y9NK98
LinkDB
Position
Unknown
AA seq 380 aa
MTVKTKAAGDTLTYSRVRGMVAILIAFMKQRRMGLNNFIQKIASNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPXKAVLKKKEEKHSMSERNVLLKNVKDPFLVGLHFSFQTADKLY
FVLDCINGGESFYHLQRERCFLEPQARCYAAEIASALGYLHSRAGSLVYRDLKPENILLV
SQGHIVLTDFGLCKENTEHNGTTSTFCGTPEYLAPEVLHKQPYDRTMDWWCLGAVLYEML
YGLSPFYSRNTAEMYDSILNKPLQLKPNITNSARHVLEGLLQKDRTKRLGAKVDFMEIKN
HVFFSLINWDDLINKKVTPPFNPNVSGPSDLGHFDPEFTEEPVPNSIGRSPDSILLPASV
KEVAEAFLGFSYAPPVDSFL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacggtgaaaaccaaggctgctggggacaccctcacttactccagggtgaggggcatg
gtagcaattctcatcgctttcatgaaacagagaaggatgggcctgaacaactttattcag
aagattgccagtaactcctatgcatgcaaacaccctgaagttcagtccattttgaaaatc
tcccaacctcaggagcctgagctcatgaatgccaacccttctcctccaccanagaaagcg
gtcctgaaaaagaaggaggaaaagcatagtatgtcagagcggaatgttctcctgaagaac
gtgaaagaccctttcctggtgggcctccacttctctttccagacggctgacaaactgtac
tttgtcctagactgcattaacggtggagagtcgttctaccatctccagagggagcgatgc
ttcctggaaccacaggctcggtgctatgctgctgaaatagccagtgccttgggttacctg
cactctcgtgcaggtagtctcgtttatagagacttaaagccagagaatattttgctggtt
tcacagggacacattgtccttactgactttggactctgcaaggagaacactgaacataat
ggcacgacgtccaccttctgcggcacacccgagtatcttgcacctgaggtgcttcataag
cagccttatgataggaccatggactggtggtgtctgggggccgtcttatatgagatgctg
tatggcctgtctcccttttatagccgaaacacagctgagatgtacgacagcattctgaac
aaacccctccagttgaagccaaatattacaaattctgcaagacacgtcctggagggcctc
ctgcagaaggacaggacaaagaggcttggtgccaaggttgactttatggagattaagaat
cacgtcttcttctccctaattaactgggatgatctcattaataagaaggttactccccct
tttaacccaaatgtgagtggacccagcgacctggggcactttgatcccgagtttaccgaa
gagcccgtccccaactccatcggtcggtcgcccgacagtatcctcctcccagccagcgtc
aaggaagtggctgaggccttcctgggcttttcctacgcacctcccgtggactctttcctc
tga

KEGG   Delphinapterus leucas (beluga whale): 111184161
Entry
111184161         CDS       T05885                                 

Gene name
SGK2
Definition
(RefSeq) serine/threonine-protein kinase Sgk2 isoform X1
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111184161 (SGK2)
   04151 PI3K-Akt signaling pathway
    111184161 (SGK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111184161 (SGK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   111184161 (SGK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo FTA2 APH
Other DBs
NCBI-GeneID: 111184161
NCBI-ProteinID: XP_022448068
UniProt: A0A2Y9PY59
LinkDB
Position
Unknown
AA seq 367 aa
MDSSPAGTPSLQPPRANGNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKHKSDGMF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNMCHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDGQGHVVLTDFGL
CKEGVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWSLGAVLYEMLHGLPPFYSQDLS
QMYENILNQPLRIPGGLTVAACDLLQALLHKDQRQRLGSQTDFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVAGPADLKHFDPEFTQEAVSKSIGCTPDTMASSAGASSAFLGFSYAPE
DDAVLDC
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggactctagcccggctgggacccccagtctgcagcccccaagggccaatgggaatatc
aacctggggccttcggccaacccaaatgcccggcccaccgacttcgacttcctcaaagtc
attggcaaaggaaactacgggaaggtcctactggccaagcacaagtccgacgggatgttc
tacgcagtgaaggtgctacagaaaaagtccatcttaaagaagaaagagcagagccacatc
atggcggagcgcagcgtgctcctgaagaacatgtgccaccccttcctcgtgggcctgcgc
tactccttccaaacgccggagaagctctactttgtgctggactatgtcaacgggggagag
ctcttcttccacctgcagcgggagcgccggttcctggagccccgggcccggttttacgcc
gccgaggtggccagcgccattggctacctgcactccctcaacatcatttacagggacctg
aaaccagagaacattcttttggacggccagggacacgtggtgctgacggattttggcctc
tgcaaggaaggtgtagagcctgaggagaccacgtccacgttctgtggcaccccagagtac
ctggctccagaagtgcttcgtaaagagccttatgatcgggcagtggattggtggtccttg
ggggccgttctctacgagatgctgcacggcctgccgcccttctacagccaagatttatcc
cagatgtatgagaacattctgaaccagccactacggatccctgggggcctgacagtggcc
gcctgtgacctcctgcaagcccttcttcacaaggaccagaggcagcggctgggctcccaa
acagactttcttgagataaagaaccatgtattcttcagccccataaactgggacgacttg
taccacaagaggctgactccacccttcaaccctaatgtggcaggacctgctgacttgaaa
cactttgacccagagttcacccaagaagctgtgtcaaagtccattggctgcactcccgac
actatggccagcagtgctggggcctcaagtgccttcctgggattttcctatgcaccggag
gatgacgccgtcttagattgctag

KEGG   Delphinapterus leucas (beluga whale): 111185579
Entry
111185579         CDS       T05885                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111185579
   04151 PI3K-Akt signaling pathway
    111185579
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111185579
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   111185579
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo APH
Other DBs
NCBI-GeneID: 111185579
NCBI-ProteinID: XP_022450973
UniProt: A0A2Y9PVS8
LinkDB
Position
Unknown
AA seq 490 aa
MDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLRKQFP
AMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRHPELYNHPDVRAFLQMDSPKHQS
DPSEDEDERSTQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGK
FYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTIEKLYFVLDFINGG
ELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFG
LCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDV
AEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWTD
LVQKKIPPPFNPNVAGPDDIRNFDAAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFS
YAPPSEDLFL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggactacaaggaaagctgtccaagtgtaagcattcccagctctgatgaacacagagag
aaaaagaagaggtttactgtttataaagttctggtttcagtgggcaggagtgagtggttt
gtcttcagaagatatgcggagttcgataagctttacaacactttaaggaaacaatttcct
gctatggccctgaagattcctgccaagagaatatttggtgataattttgatccagatttt
attaaacagagaagagcgggactgaatgaattcattcagaacttagttaggcatccagaa
ctttacaaccatccagatgtcagagcattccttcaaatggacagtccaaaacatcagtca
gatccatctgaagatgaggatgaaagaagtactcagaagctacactctacctcacagaac
attaacctgggaccatctggaaatcctcatgctaaaccaacagactttgatttcttaaaa
gttattggaaaaggcagctttggcaaggttcttcttgcaaaacggaaactggatggaaaa
ttttatgctgtcaaagtgttacagaaaaagatagttctcaacagaaaagagcaaaaacac
attatggctgaacgtaatgtgctcttgaaaaatgtgaaacatccatttttggttggattg
cattattctttccaaacaattgaaaagctttattttgttctggattttattaatggaggg
gagctgttttttcacttacaaagagaacggtcctttcctgaacacagagctaggttttat
gctgctgaaattgccagtgcattgggttatttgcactccatcaaaatagtgtacagagac
ttgaaaccagaaaatattcttttggattcagtaggacatgttgtcttaacagattttggg
ctttgtaaagaaggaattgctatttctgacaccacaacaacattttgtgggacaccagag
tacctagcacctgaagtaatcagaaaacagccctatgacaatactgtagattggtggtgc
cttggtgctgttctgtatgaaatgctgtatggattgcctcctttttattgccgagatgtt
gctgaaatgtatgacaatattcttcacaagcccctaagtttgaggccaggagtgagcctt
acagcctggtcaattctggaagaactcctagaaaaagacaggcaaaaccgactcggtgcc
aaagaagacttccttgaaattcagaatcatcctttttttgaatcactcagctggactgat
cttgtacaaaagaagattccaccaccgtttaatcctaatgtggcaggaccagatgatatc
aggaactttgatgcagcgtttacagaagaaacagttccatattccgtgtgtgtgtcttct
gactattccatagtgaacgccagcgtactggaggccgacgacgcctttgttggtttctct
tacgcacctccttcagaagacttatttttgtga

DBGET integrated database retrieval system