KEGG   Delphinapterus leucas (beluga whale): 111165994
Entry
111165994         CDS       T05885                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle04270  Vascular smooth muscle contraction
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04540  Gap junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04730  Long-term depression
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111165994 (MAP2K2)
   04012 ErbB signaling pathway
    111165994 (MAP2K2)
   04014 Ras signaling pathway
    111165994 (MAP2K2)
   04015 Rap1 signaling pathway
    111165994 (MAP2K2)
   04370 VEGF signaling pathway
    111165994 (MAP2K2)
   04371 Apelin signaling pathway
    111165994 (MAP2K2)
   04066 HIF-1 signaling pathway
    111165994 (MAP2K2)
   04068 FoxO signaling pathway
    111165994 (MAP2K2)
   04072 Phospholipase D signaling pathway
    111165994 (MAP2K2)
   04071 Sphingolipid signaling pathway
    111165994 (MAP2K2)
   04024 cAMP signaling pathway
    111165994 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    111165994 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    111165994 (MAP2K2)
   04150 mTOR signaling pathway
    111165994 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111165994 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    111165994 (MAP2K2)
   04218 Cellular senescence
    111165994 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111165994 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    111165994 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111165994 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111165994 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    111165994 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    111165994 (MAP2K2)
   04660 T cell receptor signaling pathway
    111165994 (MAP2K2)
   04662 B cell receptor signaling pathway
    111165994 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    111165994 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111165994 (MAP2K2)
   04929 GnRH secretion
    111165994 (MAP2K2)
   04912 GnRH signaling pathway
    111165994 (MAP2K2)
   04915 Estrogen signaling pathway
    111165994 (MAP2K2)
   04917 Prolactin signaling pathway
    111165994 (MAP2K2)
   04921 Oxytocin signaling pathway
    111165994 (MAP2K2)
   04926 Relaxin signaling pathway
    111165994 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    111165994 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    111165994 (MAP2K2)
   04916 Melanogenesis
    111165994 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111165994 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    111165994 (MAP2K2)
   04730 Long-term depression
    111165994 (MAP2K2)
   04722 Neurotrophin signaling pathway
    111165994 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111165994 (MAP2K2)
   05206 MicroRNAs in cancer
    111165994 (MAP2K2)
   05205 Proteoglycans in cancer
    111165994 (MAP2K2)
   05230 Central carbon metabolism in cancer
    111165994 (MAP2K2)
   05231 Choline metabolism in cancer
    111165994 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111165994 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111165994 (MAP2K2)
   05225 Hepatocellular carcinoma
    111165994 (MAP2K2)
   05226 Gastric cancer
    111165994 (MAP2K2)
   05214 Glioma
    111165994 (MAP2K2)
   05216 Thyroid cancer
    111165994 (MAP2K2)
   05221 Acute myeloid leukemia
    111165994 (MAP2K2)
   05220 Chronic myeloid leukemia
    111165994 (MAP2K2)
   05218 Melanoma
    111165994 (MAP2K2)
   05211 Renal cell carcinoma
    111165994 (MAP2K2)
   05219 Bladder cancer
    111165994 (MAP2K2)
   05215 Prostate cancer
    111165994 (MAP2K2)
   05213 Endometrial cancer
    111165994 (MAP2K2)
   05224 Breast cancer
    111165994 (MAP2K2)
   05223 Non-small cell lung cancer
    111165994 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111165994 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    111165994 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111165994 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111165994 (MAP2K2)
   05135 Yersinia infection
    111165994 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111165994 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    111165994 (MAP2K2)
   05161 Hepatitis B
    111165994 (MAP2K2)
   05160 Hepatitis C
    111165994 (MAP2K2)
   05164 Influenza A
    111165994 (MAP2K2)
   05163 Human cytomegalovirus infection
    111165994 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111165994 (MAP2K2)
   05165 Human papillomavirus infection
    111165994 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111165994 (MAP2K2)
   01522 Endocrine resistance
    111165994 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111165994 (MAP2K2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111165994 (MAP2K2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111165994 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 111165994
NCBI-ProteinID: XP_022412865
UniProt: A0A2Y9LU19
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRAMVDGAEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGIFTQDFQEFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctgcagaagaag
ctagaggagctagaacttgacgagcagcagaagaagcggctggaagccttcctcacccag
aaggccaaggtcggggagctcaaggacgatgactttgaaaggatctcggagctgggagcc
gggaacggtggggtggtcaccaaggtccagcacagaccctcgggcctcatcatggcaaga
aagctgatccacctggagatcaagccagccatccggaaccagatcatccgtgagctgcag
gtgctgcatgagtgtaactccccgtacatcgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggtggctccctggaccaggtgttgaaa
gaagccaagaggatccccgaagagatcctggggaaggtcagcatcgcggttctgcggggc
ctggcgtatctccgggagaagcaccagatcatgcaccgagatgtgaagccatccaacatc
ctcgtcaactcccgaggggagatcaagctgtgcgactttggggtgagcgggcagctcatc
gactccatggccaactccttcgtggggacgcggtcctacatgtctccggagcggctgcaa
ggcactcactactcggtgcagtcagacatctggagcatgggcctgtccctggtggagctg
tccattggaaggtaccccatccccccgccggacgccaaggagctggaggccatatttggc
cgggccatggtcgacggcgcggaaggagagcctcacagcatctcgccgcggccgagaccc
cccggacgccccatcagcggtcatgggatggacagccggccggccatggcaatctttgag
ctgctggactacatcgtgaacgagcctcctcccaagctgcccaacggcatcttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagcagagcgagcagatctg
aagatgctcatgaaccacgccttcatcaagcggtcggaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgcactgccgtc
tga

KEGG   Delphinapterus leucas (beluga whale): 111177745
Entry
111177745         CDS       T05885                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04114  Oocyte meiosis
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle04270  Vascular smooth muscle contraction
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04540  Gap junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04730  Long-term depression
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04929  GnRH secretion
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05034  Alcoholism
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111177745 (MAP2K1)
   04012 ErbB signaling pathway
    111177745 (MAP2K1)
   04014 Ras signaling pathway
    111177745 (MAP2K1)
   04015 Rap1 signaling pathway
    111177745 (MAP2K1)
   04370 VEGF signaling pathway
    111177745 (MAP2K1)
   04371 Apelin signaling pathway
    111177745 (MAP2K1)
   04668 TNF signaling pathway
    111177745 (MAP2K1)
   04066 HIF-1 signaling pathway
    111177745 (MAP2K1)
   04068 FoxO signaling pathway
    111177745 (MAP2K1)
   04072 Phospholipase D signaling pathway
    111177745 (MAP2K1)
   04071 Sphingolipid signaling pathway
    111177745 (MAP2K1)
   04024 cAMP signaling pathway
    111177745 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    111177745 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    111177745 (MAP2K1)
   04150 mTOR signaling pathway
    111177745 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111177745 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111177745 (MAP2K1)
   04210 Apoptosis
    111177745 (MAP2K1)
   04218 Cellular senescence
    111177745 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111177745 (MAP2K1)
   04540 Gap junction
    111177745 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111177745 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111177745 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111177745 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    111177745 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    111177745 (MAP2K1)
   04660 T cell receptor signaling pathway
    111177745 (MAP2K1)
   04662 B cell receptor signaling pathway
    111177745 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    111177745 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    111177745 (MAP2K1)
   04062 Chemokine signaling pathway
    111177745 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111177745 (MAP2K1)
   04929 GnRH secretion
    111177745 (MAP2K1)
   04912 GnRH signaling pathway
    111177745 (MAP2K1)
   04915 Estrogen signaling pathway
    111177745 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    111177745 (MAP2K1)
   04917 Prolactin signaling pathway
    111177745 (MAP2K1)
   04921 Oxytocin signaling pathway
    111177745 (MAP2K1)
   04926 Relaxin signaling pathway
    111177745 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    111177745 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    111177745 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    111177745 (MAP2K1)
   04916 Melanogenesis
    111177745 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111177745 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    111177745 (MAP2K1)
   04726 Serotonergic synapse
    111177745 (MAP2K1)
   04720 Long-term potentiation
    111177745 (MAP2K1)
   04730 Long-term depression
    111177745 (MAP2K1)
   04722 Neurotrophin signaling pathway
    111177745 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111177745 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177745 (MAP2K1)
   05206 MicroRNAs in cancer
    111177745 (MAP2K1)
   05205 Proteoglycans in cancer
    111177745 (MAP2K1)
   05230 Central carbon metabolism in cancer
    111177745 (MAP2K1)
   05231 Choline metabolism in cancer
    111177745 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111177745 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177745 (MAP2K1)
   05212 Pancreatic cancer
    111177745 (MAP2K1)
   05225 Hepatocellular carcinoma
    111177745 (MAP2K1)
   05226 Gastric cancer
    111177745 (MAP2K1)
   05214 Glioma
    111177745 (MAP2K1)
   05216 Thyroid cancer
    111177745 (MAP2K1)
   05221 Acute myeloid leukemia
    111177745 (MAP2K1)
   05220 Chronic myeloid leukemia
    111177745 (MAP2K1)
   05218 Melanoma
    111177745 (MAP2K1)
   05211 Renal cell carcinoma
    111177745 (MAP2K1)
   05219 Bladder cancer
    111177745 (MAP2K1)
   05215 Prostate cancer
    111177745 (MAP2K1)
   05213 Endometrial cancer
    111177745 (MAP2K1)
   05224 Breast cancer
    111177745 (MAP2K1)
   05223 Non-small cell lung cancer
    111177745 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111177745 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    111177745 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    111177745 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111177745 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111177745 (MAP2K1)
   05135 Yersinia infection
    111177745 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177745 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    111177745 (MAP2K1)
   05161 Hepatitis B
    111177745 (MAP2K1)
   05160 Hepatitis C
    111177745 (MAP2K1)
   05164 Influenza A
    111177745 (MAP2K1)
   05163 Human cytomegalovirus infection
    111177745 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111177745 (MAP2K1)
   05165 Human papillomavirus infection
    111177745 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111177745 (MAP2K1)
   01522 Endocrine resistance
    111177745 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111177745 (MAP2K1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111177745 (MAP2K1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111177745 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 111177745
NCBI-ProteinID: XP_022435548
UniProt: A0A2Y9P0A4
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELVFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHVAGI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcaaaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgccttgaggccttccttacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggtgctggcaatggaggt
gtggtgttcaaggtctcccacaagccatccggtctggttatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcatacgggagctgcaggttctacatgag
tgcaactccccttacattgtgggcttctacggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactcctttgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagg
tatcccatccctcctccagatgccaaggagctggagctggtgtttgggtgccaggtggag
ggagatgcggctgagacaccgccccggccaaggactcccggaaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaatgag
cctcctccaaaattgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccacgtggctggcatctaa

DBGET integrated database retrieval system