KEGG   Delphinapterus leucas (beluga whale): 111165995
Entry
111165995         CDS       T05885                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04913  Ovarian steroidogenesis
dle04925  Aldosterone synthesis and secretion
dle04927  Cortisol synthesis and secretion
dle04934  Cushing syndrome
dle04976  Bile secretion
dle04979  Cholesterol metabolism
dle05145  Toxoplasmosis
dle05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111165995 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    111165995 (LDLR)
   04925 Aldosterone synthesis and secretion
    111165995 (LDLR)
   04927 Cortisol synthesis and secretion
    111165995 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    111165995 (LDLR)
   04979 Cholesterol metabolism
    111165995 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111165995 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111165995 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111165995 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111165995 (LDLR)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    111165995 (LDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Other DBs
NCBI-GeneID: 111165995
NCBI-ProteinID: XP_022412868
UniProt: A0A2Y9M676
LinkDB
Position
Unknown
AA seq 857 aa
MRLEGCGLRWAVALLIAATAGAVEDKCGRNEFQCRDGTCISYKWVCDGSAECQDGSDESQ
ETCMSVTCKTGDFNCGGHVNRCIPESWRCDGQLDCENGSDEEGCPPKTCSQDEFRCNDGK
CIAPKFVCDSDLDCLDGSDEVSCPAPTCGPASFQCNSATCIPELWACDGDPDCEDGSDEW
PQHCGSPQPSDPAQGNNPCSALEFHCRSGECIHSSWHCDHDPDCKDKSDEENCAVATCRP
DEFQCSDGTCIHGSRQCDREYDCKDLSDELGCINVTLCEGPNKFKCQSGECISLDKVCDS
VRDCRDWSDEPLKECGTNECLDNKGGCSHICNDLKIGYECLCPEGFQLADKHRCEDIDEC
QDPDACSQLCVNLEGSYKCQCEEGFQLEPLTKACKAVGTIAYLFFTNRHEVRKMTLDRSE
YASVIPNLKNVVALDTEVASNRIYWSDLSQRKIYSAQINRASSFSSYDTVISEDLQAPDG
LAVDWIHSNIYWTDSILGTISVADTKGVKRKTLFQEKGSKPRAIVVDPIHGFMYWTDWGT
PAKIKKGGLNGVDVYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVTGGNRKTI
LEDKKNLAHPFSLAIFEDKVFWTDIVNEAIFSANRLTGLDINLMAENLLSPEDIVLFHNL
TQPRGVNWCERTALRNGGCQYLCLPAPQINPRSPRFTCACPDGTRLAEDMRSCLAGGGTS
LPPATLAETEPAVTTWRPSTVNSTTVGPKRTASPELTTAESVTMSQQVLGDVAGRADAER
PQGVGALYIVLPIALLILLCFGTFLLWKNWRLKSINSINFDNPVYQKTTEDEVHICRSQD
GYTYPSRQMVSLEDDVA
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgaggcttgagggctgcgggctgcgctgggccgtcgccctgctcatcgctgcgactgcg
ggtgcagtggaagacaaatgtgggagaaatgagttccagtgccgagatgggacatgcatc
tcctacaagtgggtttgcgacgggagcgctgagtgccaggatggctccgatgagtcccag
gagacgtgcatgtctgtcacctgcaagacaggggacttcaactgtgggggccatgtcaat
cgctgcattcctgagtcctggagatgcgacggccagctggactgcgagaacggctcagac
gaggaaggctgtccccccaagacgtgctcccaggatgagttccgctgcaatgacggcaag
tgcatcgccccgaagttcgtctgcgactcggacctggactgcttagatggctcagacgag
gtgtcctgccctgcgcccacctgcggccctgccagcttccagtgcaacagtgccacctgc
atccccgagctctgggcctgcgacggcgaccccgactgcgaagatggctcggacgagtgg
ccgcagcactgtgggagcccccagccgtcggaccctgcacagggcaacaacccctgctcg
gccctcgagttccattgtcgcagcggcgaatgcatccactccagctggcactgcgaccac
gaccccgactgcaaggacaagtctgacgaggagaactgtgccgtggccacctgccggcct
gacgagttccagtgctcggatgggacctgcatccacggcagccggcagtgcgacagggag
tatgactgtaaggacctgagcgacgagctgggctgcatcaatgtgactctgtgtgaggga
cccaacaagttcaagtgccaaagcggcgagtgcatctccctggacaaagtgtgcgactca
gtcagggactgccgagactggtcggacgaacccctcaaggagtgcgggaccaacgagtgt
ctggacaacaagggcggctgctcccacatctgcaacgacctcaagatcggctacgagtgc
ctgtgtcctgagggcttccagctggcggacaagcacagatgtgaagacatcgacgagtgt
caggacccagacgcctgcagccagctctgcgtgaacctcgagggcagctacaagtgccag
tgtgaggagggcttccagctggagcccctcaccaaggcctgcaaggccgtgggcaccatc
gcctacctcttcttcaccaaccgccacgaagtgaggaagatgactctggaccgcagcgag
tatgccagcgtcattcccaacctgaagaacgtggtcgccctggacacggaggtggccagc
aacagaatctactggtccgacctgtcccagaggaagatctacagcgcccagatcaacaga
gcctccagcttctcttcctacgacactgtcatcagcgaggatctccaggcccccgatggg
ctggcagtggattggatccacagcaacatatactggactgactccatcctgggcaccatc
tcagtggctgacaccaagggtgtgaagaggaagacgctcttccaagagaaaggctccaag
ccacgggccattgtggtggatcccatccacggcttcatgtattggacagactggggaacc
cccgctaagatcaagaaggggggcctgaatggcgtggacgtttactcgctggtgacggag
gacatccagtggcccaatggcatcaccctggatctttccagcggccgcctgtactgggtc
gactcgaagctgcactccatctccagcattgatgtcactgggggcaaccggaagaccatc
ctagaggacaagaagaatcttgcgcaccccttctccttggccatctttgaggataaagta
ttttggacggatattgtcaatgaagccattttcagtgccaaccgcctcacgggcttggac
attaatttgatggcagaaaacctgctttctccagaggacatcgtccttttccacaacctc
acgcagccgagaggggtgaactggtgtgagaggactgccctccgcaacggtggctgccag
tacctgtgtctgccagccccgcagatcaacccccgctcgcccaggttcacctgtgcctgc
cccgacggcacgcggctggccgaggacatgagaagctgccttgcaggtgggggcaccagt
ctgcctcctgccacccttgcagagactgaacctgcagtgaccacctggaggccctccacg
gtcaactcgacaaccgtgggtccgaagcgcacagccagtcctgagctcaccacggcagag
tcagtgacgatgtcccaacaagtcctgggtgatgttgccggccgagcggatgcggagagg
ccccagggcgtgggtgctctgtacatcgtcctcccaatcgcgctgctcatcctcctgtgc
ttcgggaccttcctcctctggaagaactggcggcttaagagcatcaacagcatcaacttt
gacaaccctgtgtaccagaagaccacggaggacgaggtccacatctgccgcagccaggat
ggctacacctacccatcgagacagatggtcagcctagaggatgacgtggcgtga

DBGET integrated database retrieval system