KEGG   Delphinapterus leucas (beluga whale): 111166011
Entry
111166011         CDS       T05885                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04141  Protein processing in endoplasmic reticulum
dle04380  Osteoclast differentiation
dle04530  Tight junction
dle04620  Toll-like receptor signaling pathway
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04912  GnRH signaling pathway
dle04926  Relaxin signaling pathway
dle05010  Alzheimer disease
dle05016  Huntington disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05161  Hepatitis B
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111166011 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111166011 (MAP2K7)
   04012 ErbB signaling pathway
    111166011 (MAP2K7)
   04668 TNF signaling pathway
    111166011 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111166011 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111166011 (MAP2K7)
   04660 T cell receptor signaling pathway
    111166011 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    111166011 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111166011 (MAP2K7)
   04926 Relaxin signaling pathway
    111166011 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111166011 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111166011 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111166011 (MAP2K7)
   05016 Huntington disease
    111166011 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    111166011 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111166011 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111166011 (MAP2K7)
   05135 Yersinia infection
    111166011 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111166011 (MAP2K7)
   05161 Hepatitis B
    111166011 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166011 (MAP2K7)
   05169 Epstein-Barr virus infection
    111166011 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166011 (MAP2K7)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111166011 (MAP2K7)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111166011 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111166011
NCBI-ProteinID: XP_022412920
UniProt: A0A2Y9LU68
LinkDB
Position
Unknown
AA seq 458 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQVPPFPRRPP
GRVGRTLLVGLGWGWRAEARWTPSPGSPRQRYQAEINDLENLGEMGSGTCGQVWKMRFRK
TGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGT
CAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCD
FGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFP
YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIK
RYETLEVDVASWFKDVMAKTESPRASGVLSQHHLPFFR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgcgaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccactggccaacgatgggggcagccgctcaccgtcctccgagagc
tccccgcagcaccccacgccccccgcacggccccgccacatgctggggctcccgtcaacc
ttgttcacaccccgcagcatggagagcatcgagattgaccagaagctgcaggagatcatg
aagcagacgggctatctgaccattgggggccaggtaccgcccttccctcggcgtccccca
gggagggtgggcaggacgctgctggtaggtctgggctgggggtggagggcagaggcccgg
tggacccccagccctggctctcctcgccagcgctaccaggcggaaatcaatgacctggag
aacctgggggagatgggcagcggcacctgtggccaggtgtggaagatgcgtttccggaag
acggggcacgtcatcgctgtcaagcaaatgcggcgctcggggaacaaggaagagaacaaa
cggatcctcatggacctggacgtggtgctcaagagccacgattgcccctacatcgtgcag
tgcttcgggaccttcatcaccaacacggacgtcttcattgccatggagctcatgggcacg
tgcgccgagaagctcaagaagcggatgcagggccctatccctgagcggatcctgggcaag
atgacggtggcgatcgtgaaggcactctactacctgaaggagaagcacggcgtgatccac
cgggacgtcaagccctccaacatcctgctggatgagcggggccagatcaagctctgcgac
ttcggcatcagcggccgcctcgttgactccaaagccaaaacacggagcgcgggttgcgct
gcctacatggcacctgagcgcatcgaccccccggaccccaccaagcccgactacgacatc
cgggccgacgtgtggagcctgggcatctctttggtggagctggcgacgggacagtttccc
tacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagaaccccca
ctcctgcccggtcacatgggcttctcgggggactttcagtccttcgtcaaagactgcctt
actaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttcatcaag
cgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaagacc
gagtcgccgcgggcgagcggggtcctgagccagcaccacctgcccttcttcaggtag

KEGG   Delphinapterus leucas (beluga whale): 111186018
Entry
111186018         CDS       T05885                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04620  Toll-like receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04912  GnRH signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05142  Chagas disease
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111186018 (MAP2K4)
   04012 ErbB signaling pathway
    111186018 (MAP2K4)
   04668 TNF signaling pathway
    111186018 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111186018 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    111186018 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111186018 (MAP2K4)
   04926 Relaxin signaling pathway
    111186018 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    111186018 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111186018 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111186018 (MAP2K4)
   05135 Yersinia infection
    111186018 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186018 (MAP2K4)
   05161 Hepatitis B
    111186018 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186018 (MAP2K4)
   05169 Epstein-Barr virus infection
    111186018 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111186018 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186018 (MAP2K4)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111186018 (MAP2K4)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111186018 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 111186018
NCBI-ProteinID: XP_022451931
UniProt: A0A2Y9Q357
LinkDB
Position
Unknown
AA seq 399 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPAGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtggggtctccggcgcccggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctgcaggagttcaaaacccacacatagagagactgagaacacacagc
attgaatcgtcaggaaaactgaagatctcccctgagcagcactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcggttaaaagaattcggtcaacagtggatgagaaa
gagcaaaaacaacttctcatggatttggatgtagtgatgcgaagtagtgattgcccgtac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaatcattcacagagatatcaaaccttccaatattcttctggatagaagt
ggaaatattaaactctgcgactttggcatcagtggacagcttgtggactccattgccaag
acaagagatgctggatgcaggccatacatggcacctgaaagaatagacccaagtgcgtca
cgacaaggatatgacgtccgctctgatgtctggagtttggggatcacattgtacgaattg
gccacaggccgatttccttatccaaagtggaatagtgtgtttgatcaactaacacaagtt
gtgaaaggagacccaccacagttgagtaattctgaggaaagggaattttccccaagtttc
atcaactttgtcaacttgtgccttaccaaggatgaatccaaaaggccaaagtataaagaa
cttctgaaacatccctttattttgatgtatgaagagcgcgctgtcgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgactga

DBGET integrated database retrieval system