KEGG   Delphinapterus leucas (beluga whale): 111166017
Entry
111166017         CDS       T05885                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166017 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166017 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111166017 (TYK2)
   04658 Th1 and Th2 cell differentiation
    111166017 (TYK2)
   04659 Th17 cell differentiation
    111166017 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111166017 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111166017 (TYK2)
   05160 Hepatitis C
    111166017 (TYK2)
   05171 Coronavirus disease - COVID-19
    111166017 (TYK2)
   05164 Influenza A
    111166017 (TYK2)
   05162 Measles
    111166017 (TYK2)
   05168 Herpes simplex virus 1 infection
    111166017 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166017 (TYK2)
   05169 Epstein-Barr virus infection
    111166017 (TYK2)
   05165 Human papillomavirus infection
    111166017 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111166017 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166017 (TYK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111166017 (TYK2)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111166017 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 111166017
NCBI-ProteinID: XP_022412939
UniProt: A0A2Y9LU92
LinkDB
Position
Unknown
AA seq 1188 aa
MPLCQWGATTRGRKPDGDGAQPMATRGGLKVLLHWAGPGGGEPWVTFSEATLTAEEVCLH
IAHKVGITPPCFNLFALFDVQAQVWLPPNHILDMSRDSSLMLYFRMRFYFRNWHGMHPQE
PAVYRCGPPGSEPSSEQAEQGVQLLDPASFEYLFEQGKHEFINDVASLWELSSEEEIHHF
QNESLGMAFLHLCHLALCHDVPLEKVAKKISFKDCIPRSFRQQIRQHNALTRLRLRSIFR
KFLRAFQPGCLSQQVVMVKYLATLERLAPRFGTERVPVCHLELLAQAEGEPCYIRDGGQA
PPDPGPESATGPPTHEVLVSGTDGIQWRLVQAETPSDGGGGGGRRMPHAGPSGKKAKAQE
VGNQPVHRPQEAPWAYFCDFQDITHVVLKERRVSIHCQDNKCLELTLPSRAAALSLVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVLARLQPEDGLYLIHWSTSHL
HRLILTVAQRDQAPGVKGLHLRKFPIELQAGTVALEGWDRSFPSVRELRVALQGCSLRAG
DDCFSLRHCCLPRPGEISNLIVTRGPRASSRPLNLSHLSFHQIRQEDITQLSHLGQGTRT
NVYEGLLRVEGGGPEEDKVDGGDPPMPGAGCEQELRVVLKVLDPSHHDIALAFYETASLM
SQVSHVHLVFVHGIYVHGSENIMVTEYVEHGPLDVWLRRERGHVPLAWKLAVAQQLASAL
SYLEDKSLVHSNVCGRNILLARLGLAEGTSPFIKLSDPGVGLSVLSREERVERIPWTAPE
CLSGGANSLSTAADKWGFGATLLEICFDGEAPLQGRSPSEKERFYQKQQKLPEPSCPELA
ILTSQCLTYEPAQRPSFRTILRDLTQLQPQTLPDLVDVLSVNPDSPASDPTVFHKRYLKK
IRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKAGCGPQLRTGWRREIEILRTLYHQHI
VKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHNVGLAQLLLFSQQICEGMAYLHAQHY
VHRDLAARNVLLDNNRLVKIGDFGLAKAVPEGHEYYCVREDGDSPVFWYAPECLKECKFY
YASDVWSFGVTMYELLTYCDSTQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPQPEK
CPCEIYCLMKNCWKAEASFRPTFQNLIPILKTVHEKYQGQAASVFSVC
NT seq 3567 nt   +upstreamnt  +downstreamnt
atgcctctgtgccaatggggggccaccaccaggggcagaaagcccgatggggatggagct
cagcccatggccaccagaggaggcctgaaggtgcttctgcactgggctggccccggtggc
ggggagccctgggtcaccttcagcgaggccacactgactgcggaggaggtctgcctccac
attgcacacaaagtcggcatcactccaccctgcttcaatctttttgccctcttcgatgtc
caggcccaggtctggctgcctccaaaccacatcctggatatgtccagagactcgagcctg
atgctgtacttccgcatgaggttttatttccggaactggcatggcatgcatccccaggag
ccggctgtgtaccgctgtggtcccccagggtccgagccttcctcagaacaggccgagcag
ggggtgcaactcctggaccccgcctcctttgagtacctctttgagcagggcaagcatgag
ttcataaatgacgtggcatcgctgtgggagctgtcaagcgaggaggagatccaccacttt
cagaacgagagcctgggcatggcctttttgcacctctgccacctcgctctctgccatgat
gtcccccttgagaaggtggccaagaagatcagcttcaaggactgcatcccacgctccttc
cggcagcagatccgacagcacaatgctctgacgcggctgcgcctgcggagcatcttccgc
aagttcctgcgggccttccagccaggctgcctctcccagcaggttgtcatggtgaagtac
ctggccacactcgagcggctggcgccccgcttcggcacagagcgcgtgcccgtgtgccac
ctggagctactggcccaggccgagggggagccctgctacatccgggatggcggacaggcc
cctcccgaccccgggcccgagtctgccacaggaccccccactcacgaggtgctggtgtcg
ggcaccgacggcatccagtggcggctggtacaggcagagactcccagtgatggtggtggt
ggtggcggcagaaggatgccccatgctggcccatctgggaagaaagccaaggcccaggag
gtgggcaaccagccagtgcacagacctcaggaggccccatgggcctacttctgcgacttc
caggacattacccacgtggtgctgaaagaacgccgcgtcagcattcattgtcaggacaac
aagtgcctggagttgaccctgccttcccgggctgcagccctgtccttggtgtcactggtg
gatggctacttccgcctgacggccgactcgagccactacctatgccatgaggtggctcct
ccacggctggtgatgagtatccaggacggtatccacggacccctgctggagccgtttgtg
ctggccaggctgcagcccgaggacggcctttacctcatccactggagcaccagccacctc
caccgccttatcctcacggtggcccagcgtgaccaggcacctggcgtgaagggcttgcac
ctacggaagttccccatcgagttgcaggctgggactgtcgcgctggagggctgggaccgg
tccttccccagcgtgcgcgagctgcgggttgccctgcagggctgctccctgcgggctggc
gacgactgcttttccctgcgccactgctgcctgccacggccaggagagatctccaacctc
atcgtcacgcggggacctcgggccagcagcaggccactcaacctcagccatctcagcttc
caccagatccgccaggaagacatcacccagctgtcccacttgggccagggcacgaggacc
aatgtgtatgagggcctcttgcgagtggagggcggaggccctgaagaggacaaggtggat
ggcggggacccccccatgcccggggcgggctgtgaacaggagctgcgagtggtactcaag
gtgctagatcccagtcaccatgacatcgccctggccttctacgagacagccagcctcatg
agccaggtctcccacgtgcacctggtcttcgtgcatggcatctacgtgcatggctccgag
aatatcatggtgacggagtacgtggagcacgggcccctggacgtgtggctgcggcgggag
aggggccacgtgcccctggcctggaagctggcagtggcccagcagctggccagcgccctc
agctacctggaagacaagagcctggttcacagcaacgtgtgtggccggaacatcctcctg
gcacggctggggctggcggagggcaccagccccttcatcaagctgagtgaccccggtgtg
ggcctgagcgtcctctccagggaggaacgggtggagcggatcccctggacagcccctgag
tgcctgtccggtggagccaacagcctaagcactgcagccgacaagtggggctttggtgcc
accctcctggagatctgtttcgatggggaggcccccctgcagggccgcagcccctccgag
aaagagcgcttctaccagaagcagcagaagctgcctgagccctcgtgcccagagctggcc
atactcaccagccagtgcctgacctatgagccagcccagcggccatccttccgcaccatc
ctgcgtgacctcactcagctgcagccccaaactcttccagatctcgttgatgtcttgtct
gtgaacccggactcaccggcgtcagatcctacggttttccacaagcgctatttgaaaaag
atcagggatctgggtgagggtcacttcggaaaggtcagcctgtactgctacgatccaacc
aatgacggcactggtgagatggtggccgtgaaggccctcaaggcaggctgcggtccccag
ctccgtacaggctggaggcgagaaatcgaaatcttgcgcacactctaccaccagcacatt
gtcaagtacaagggctgctgcgaggaccaaggcgagaagtcggtacagctggtcatggag
tacgtgcccctgggcagcctccgagactacttgcctcggcacaatgtcgggctggcccag
ctgctgctcttctcccagcagatctgtgagggtatggcctacctgcacgcgcagcactac
gtgcaccgagacctggccgcacgcaacgtgctgctggacaacaacaggctggtcaagatt
ggggacttcggtctcgccaaggccgtgcccgaaggccatgagtactactgtgtgcgcgag
gatggggacagtcccgtgttctggtatgccccggagtgcctgaaggagtgtaagttctac
tatgcatccgacgtctggtcctttggggtcaccatgtatgagctgctgacctactgtgac
tccacccagagccccccctcgaaattcatcgagctcataggcctcacccaggggcagatg
acagtgctgaggctcactgagctgctggaacgaggagagaggctgccacagccagagaaa
tgtccctgtgagatctattgcctcatgaagaactgctggaaagcagaggcctcattccgc
ccgaccttccagaacctcatacccatcctcaaaacggtccacgagaaataccaaggccag
gcagcctcagtgttcagtgtctgctga

DBGET integrated database retrieval system