KEGG   Delphinapterus leucas (beluga whale): 111166017
Entry
111166017         CDS       T05885                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166017 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166017 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111166017 (TYK2)
   04658 Th1 and Th2 cell differentiation
    111166017 (TYK2)
   04659 Th17 cell differentiation
    111166017 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111166017 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    111166017 (TYK2)
   05160 Hepatitis C
    111166017 (TYK2)
   05171 Coronavirus disease - COVID-19
    111166017 (TYK2)
   05164 Influenza A
    111166017 (TYK2)
   05162 Measles
    111166017 (TYK2)
   05168 Herpes simplex virus 1 infection
    111166017 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166017 (TYK2)
   05169 Epstein-Barr virus infection
    111166017 (TYK2)
   05165 Human papillomavirus infection
    111166017 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111166017 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166017 (TYK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111166017 (TYK2)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111166017 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 111166017
NCBI-ProteinID: XP_022412939
UniProt: A0A2Y9LU92
LinkDB
Position
Unknown
AA seq 1188 aa
MPLCQWGATTRGRKPDGDGAQPMATRGGLKVLLHWAGPGGGEPWVTFSEATLTAEEVCLH
IAHKVGITPPCFNLFALFDVQAQVWLPPNHILDMSRDSSLMLYFRMRFYFRNWHGMHPQE
PAVYRCGPPGSEPSSEQAEQGVQLLDPASFEYLFEQGKHEFINDVASLWELSSEEEIHHF
QNESLGMAFLHLCHLALCHDVPLEKVAKKISFKDCIPRSFRQQIRQHNALTRLRLRSIFR
KFLRAFQPGCLSQQVVMVKYLATLERLAPRFGTERVPVCHLELLAQAEGEPCYIRDGGQA
PPDPGPESATGPPTHEVLVSGTDGIQWRLVQAETPSDGGGGGGRRMPHAGPSGKKAKAQE
VGNQPVHRPQEAPWAYFCDFQDITHVVLKERRVSIHCQDNKCLELTLPSRAAALSLVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVLARLQPEDGLYLIHWSTSHL
HRLILTVAQRDQAPGVKGLHLRKFPIELQAGTVALEGWDRSFPSVRELRVALQGCSLRAG
DDCFSLRHCCLPRPGEISNLIVTRGPRASSRPLNLSHLSFHQIRQEDITQLSHLGQGTRT
NVYEGLLRVEGGGPEEDKVDGGDPPMPGAGCEQELRVVLKVLDPSHHDIALAFYETASLM
SQVSHVHLVFVHGIYVHGSENIMVTEYVEHGPLDVWLRRERGHVPLAWKLAVAQQLASAL
SYLEDKSLVHSNVCGRNILLARLGLAEGTSPFIKLSDPGVGLSVLSREERVERIPWTAPE
CLSGGANSLSTAADKWGFGATLLEICFDGEAPLQGRSPSEKERFYQKQQKLPEPSCPELA
ILTSQCLTYEPAQRPSFRTILRDLTQLQPQTLPDLVDVLSVNPDSPASDPTVFHKRYLKK
IRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKAGCGPQLRTGWRREIEILRTLYHQHI
VKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHNVGLAQLLLFSQQICEGMAYLHAQHY
VHRDLAARNVLLDNNRLVKIGDFGLAKAVPEGHEYYCVREDGDSPVFWYAPECLKECKFY
YASDVWSFGVTMYELLTYCDSTQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPQPEK
CPCEIYCLMKNCWKAEASFRPTFQNLIPILKTVHEKYQGQAASVFSVC
NT seq 3567 nt   +upstreamnt  +downstreamnt
atgcctctgtgccaatggggggccaccaccaggggcagaaagcccgatggggatggagct
cagcccatggccaccagaggaggcctgaaggtgcttctgcactgggctggccccggtggc
ggggagccctgggtcaccttcagcgaggccacactgactgcggaggaggtctgcctccac
attgcacacaaagtcggcatcactccaccctgcttcaatctttttgccctcttcgatgtc
caggcccaggtctggctgcctccaaaccacatcctggatatgtccagagactcgagcctg
atgctgtacttccgcatgaggttttatttccggaactggcatggcatgcatccccaggag
ccggctgtgtaccgctgtggtcccccagggtccgagccttcctcagaacaggccgagcag
ggggtgcaactcctggaccccgcctcctttgagtacctctttgagcagggcaagcatgag
ttcataaatgacgtggcatcgctgtgggagctgtcaagcgaggaggagatccaccacttt
cagaacgagagcctgggcatggcctttttgcacctctgccacctcgctctctgccatgat
gtcccccttgagaaggtggccaagaagatcagcttcaaggactgcatcccacgctccttc
cggcagcagatccgacagcacaatgctctgacgcggctgcgcctgcggagcatcttccgc
aagttcctgcgggccttccagccaggctgcctctcccagcaggttgtcatggtgaagtac
ctggccacactcgagcggctggcgccccgcttcggcacagagcgcgtgcccgtgtgccac
ctggagctactggcccaggccgagggggagccctgctacatccgggatggcggacaggcc
cctcccgaccccgggcccgagtctgccacaggaccccccactcacgaggtgctggtgtcg
ggcaccgacggcatccagtggcggctggtacaggcagagactcccagtgatggtggtggt
ggtggcggcagaaggatgccccatgctggcccatctgggaagaaagccaaggcccaggag
gtgggcaaccagccagtgcacagacctcaggaggccccatgggcctacttctgcgacttc
caggacattacccacgtggtgctgaaagaacgccgcgtcagcattcattgtcaggacaac
aagtgcctggagttgaccctgccttcccgggctgcagccctgtccttggtgtcactggtg
gatggctacttccgcctgacggccgactcgagccactacctatgccatgaggtggctcct
ccacggctggtgatgagtatccaggacggtatccacggacccctgctggagccgtttgtg
ctggccaggctgcagcccgaggacggcctttacctcatccactggagcaccagccacctc
caccgccttatcctcacggtggcccagcgtgaccaggcacctggcgtgaagggcttgcac
ctacggaagttccccatcgagttgcaggctgggactgtcgcgctggagggctgggaccgg
tccttccccagcgtgcgcgagctgcgggttgccctgcagggctgctccctgcgggctggc
gacgactgcttttccctgcgccactgctgcctgccacggccaggagagatctccaacctc
atcgtcacgcggggacctcgggccagcagcaggccactcaacctcagccatctcagcttc
caccagatccgccaggaagacatcacccagctgtcccacttgggccagggcacgaggacc
aatgtgtatgagggcctcttgcgagtggagggcggaggccctgaagaggacaaggtggat
ggcggggacccccccatgcccggggcgggctgtgaacaggagctgcgagtggtactcaag
gtgctagatcccagtcaccatgacatcgccctggccttctacgagacagccagcctcatg
agccaggtctcccacgtgcacctggtcttcgtgcatggcatctacgtgcatggctccgag
aatatcatggtgacggagtacgtggagcacgggcccctggacgtgtggctgcggcgggag
aggggccacgtgcccctggcctggaagctggcagtggcccagcagctggccagcgccctc
agctacctggaagacaagagcctggttcacagcaacgtgtgtggccggaacatcctcctg
gcacggctggggctggcggagggcaccagccccttcatcaagctgagtgaccccggtgtg
ggcctgagcgtcctctccagggaggaacgggtggagcggatcccctggacagcccctgag
tgcctgtccggtggagccaacagcctaagcactgcagccgacaagtggggctttggtgcc
accctcctggagatctgtttcgatggggaggcccccctgcagggccgcagcccctccgag
aaagagcgcttctaccagaagcagcagaagctgcctgagccctcgtgcccagagctggcc
atactcaccagccagtgcctgacctatgagccagcccagcggccatccttccgcaccatc
ctgcgtgacctcactcagctgcagccccaaactcttccagatctcgttgatgtcttgtct
gtgaacccggactcaccggcgtcagatcctacggttttccacaagcgctatttgaaaaag
atcagggatctgggtgagggtcacttcggaaaggtcagcctgtactgctacgatccaacc
aatgacggcactggtgagatggtggccgtgaaggccctcaaggcaggctgcggtccccag
ctccgtacaggctggaggcgagaaatcgaaatcttgcgcacactctaccaccagcacatt
gtcaagtacaagggctgctgcgaggaccaaggcgagaagtcggtacagctggtcatggag
tacgtgcccctgggcagcctccgagactacttgcctcggcacaatgtcgggctggcccag
ctgctgctcttctcccagcagatctgtgagggtatggcctacctgcacgcgcagcactac
gtgcaccgagacctggccgcacgcaacgtgctgctggacaacaacaggctggtcaagatt
ggggacttcggtctcgccaaggccgtgcccgaaggccatgagtactactgtgtgcgcgag
gatggggacagtcccgtgttctggtatgccccggagtgcctgaaggagtgtaagttctac
tatgcatccgacgtctggtcctttggggtcaccatgtatgagctgctgacctactgtgac
tccacccagagccccccctcgaaattcatcgagctcataggcctcacccaggggcagatg
acagtgctgaggctcactgagctgctggaacgaggagagaggctgccacagccagagaaa
tgtccctgtgagatctattgcctcatgaagaactgctggaaagcagaggcctcattccgc
ccgaccttccagaacctcatacccatcctcaaaacggtccacgagaaataccaaggccag
gcagcctcagtgttcagtgtctgctga

KEGG   Delphinapterus leucas (beluga whale): 111166590
Entry
111166590         CDS       T05885                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04062  Chemokine signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05223  Non-small cell lung cancer
dle05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166590 (JAK3)
   04151 PI3K-Akt signaling pathway
    111166590 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166590 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111166590 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166590 (JAK3)
   04659 Th17 cell differentiation
    111166590 (JAK3)
   04062 Chemokine signaling pathway
    111166590 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166590 (JAK3)
   05203 Viral carcinogenesis
    111166590 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111166590 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    111166590 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166590 (JAK3)
   05161 Hepatitis B
    111166590 (JAK3)
   05162 Measles
    111166590 (JAK3)
   05169 Epstein-Barr virus infection
    111166590 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166590 (JAK3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111166590 (JAK3)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111166590 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH Kdo SH2
Other DBs
NCBI-GeneID: 111166590
NCBI-ProteinID: XP_022414132
UniProt: A0A2Y9M4G7
LinkDB
Position
Unknown
AA seq 1104 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRLPMGLSLKEQGECLSLAVLDLAQMALEQGQR
PEELLKTISYKVCLPPGLRDMIQGLNFVTRRRIQRTVRRALRRLAACQADKHSLMAKYIM
DLERLDPDRATETFRVGLPGAAGGQDAPGQLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPRFGPAGEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSGHYFC
KEVAPPRLLEQVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVPTP
LGPDYKGCLIRCDPTGTFSLAGLGQPHSSLRELLAAYWGGGLHVDGVELNLTFCCTPRPK
EKSNLIVVRRDCNPPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVYLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGALAPHDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRLSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCERDVPALCRLLELLADGQRLPAPPACPGEVHELMKLCWAP
SPQDRPPFSTLGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacgcccctgatccctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcacgtgctgctgcccccgcggggccctggacccccacagtgc
ctatccttctcctttggggaccactcagctgaagagctatgtgtttgggctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggccttggaggacctgtcctgt
tggttccccccgagccacatcttctccgtggaggacacgggcacccaggtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgccaccgctttgggcta
cgaaaggacttagccagtgccatccttgacctgccagtcctggagcacctctttgcccag
caccgcaatgacctggtcagtggccgcctcccgatgggcctcagcctcaaggagcagggt
gagtgtctcagcttggctgtgctggacctggcccagatggccctcgagcagggtcagcgg
cccgaggagctgctgaagaccatcagctacaaggtctgcctgcccccgggcctgcgcgac
atgatccagggcctgaacttcgtgacgcggaggcgtatccaaaggacagtgcgccgggcc
ttgcgccgcttggccgcctgccaggctgataagcactcgctcatggccaagtacatcatg
gacctcgagcggctggacccagacagggccaccgagaccttccgcgtgggcctccccgga
gctgctggtggtcaggatgcgccggggcagctccgcgtggctggcggcagtggcatcgcc
tggagcccgggagaacacgaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggccccacgctttggccccgccggggagcaccgcctggtcaccatc
accaggacagacaaccagatcctggaggccgagttcccggggctgcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccactgactccgggcactacttctgc
aaggaggtggcgccgccgcggctgctggagcaggtggctgagcagtgccatggccccatc
accttggattttgccatcaacaaactcaagactgggggttcacttccaggctcctacgtt
ctccgccgcagtccccaggatttcgacagctacctcctaactgtctgtgtcccgaccccc
ctgggccctgattacaagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccagccccacagcagtcttcgagagctcctggcagcctattggggtggt
gggttgcacgtggatggggttgagctgaacctcaccttctgctgcacccccagacccaaa
gaaaagtccaatctgattgtggtccggagagattgcaacccacccacatcatcccctgtt
cagccccaatcccaatgccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggtcacgggtcctttaccaagatttaccggggctgtcgc
catgaggttgtggatggggaggcccgagagacagaggtgctgctcaaagtgatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcatccttgatgagccaagtgtcg
taccagcatctcgtgttgctccatggcgtgtgcatggctggagacagcataatggtgcag
gaatttgtatacctgggagcgctggacacgtatctgcgcaagtgtggccagctggtgccg
gccagctggaagctacaggtgatcaaacagctggcttatgccctcaactatctggaagac
aaaggtctccctcacggcaatgtctcagcccggaaggtgctcctggctcgggagggggct
gacgggaacctacctttcatcaagctgagtgaccccggtgtcagcccgactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgagtgtctccaggaggcccga
acacttggcttggaagctgacaagtggggatttggtgccacagtctgggaggtgttcagc
ggtgtcacaatgcccatcagcaccctggatcctgccaagaagctccagttttaccaggaa
cggcagcaactgcctgcacccaagtggatggagctggccctgctcatccaacagtgcatg
gcctacgagccaggccagaggccctctttccgcgctgtcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggtgccctggctccccatgat
gggctttggaatggcgcccagctctatgcctgccaggaccctaccatctttgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggaactgtgccgc
tatgacccgctgggcgacaacacaggtgccctggtggccgtgaagcagttgcagcacagc
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtcagctatggcccaggccgcctgagcctgcggctg
gtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcggcaccgcgcgcgc
cttgacgctggccgcctgctcctctacgcctcgcaaatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcagcccgtaacatcctggtggagagcgag
acgcatgtcaaaatcgcagacttcggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccgcgagccaggccagagccccatcttctggtacgccccagagtccctctcg
gacaacatcttctcgcgccagtcggatgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagagctgtagcccctcagccgagttcttgcggatgatgggatgt
gagagagatgtgccagccctctgccgcctcctggagctgctggccgacggccagaggctg
cccgcacctcctgcctgtcctggtgaggttcatgagctcatgaagctgtgctgggcccct
agcccacaagaccggccaccattcagcaccctgggcccccagctggatgcactgtggagt
ggaagccagggatag

KEGG   Delphinapterus leucas (beluga whale): 111174651
Entry
111174651         CDS       T05885                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04062  Chemokine signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04725  Cholinergic synapse
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05140  Leishmaniasis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05164  Influenza A
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111174651 (JAK2)
   04151 PI3K-Akt signaling pathway
    111174651 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111174651 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111174651 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111174651 (JAK2)
   04659 Th17 cell differentiation
    111174651 (JAK2)
   04062 Chemokine signaling pathway
    111174651 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111174651 (JAK2)
   04917 Prolactin signaling pathway
    111174651 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    111174651 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    111174651 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174651 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111174651 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111174651 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111174651 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111174651 (JAK2)
   05164 Influenza A
    111174651 (JAK2)
   05168 Herpes simplex virus 1 infection
    111174651 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111174651 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111174651 (JAK2)
   05140 Leishmaniasis
    111174651 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111174651 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111174651 (JAK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111174651 (JAK2)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111174651 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 111174651
NCBI-ProteinID: XP_022429344
UniProt: A0A2Y9N3T7
LinkDB
Position
Unknown
AA seq 1132 aa
MRMACLTMTEMEGTSSSPVHQNGDIPGNANSVKQIDPVLQVYLYHSLGKAEGDYLKFPTG
EYVAEEICVAASKACGVTPVYHSMFALMNETERIWYPPNHVFHIDESTRHNVLYRVRFYF
PYWYCNGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLDIYSSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVSIKQANQEGSNESRIVTIHKQDGKSLEIELRSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPISMDFAISKLKKTGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLTGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVPTSPTLQRHNNVNQMVFHKI
RNEDLIFHESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDIYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKTLIHGNVCTKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYENRHQLPAPKWTEL
ANLIHNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQGKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRDLALRVDQIRDSMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgcgaatggcatgccttacaatgacagaaatggaaggaacatcctcatctcctgtacat
cagaatggtgatattcctggaaatgctaattctgtgaagcaaatagatccagtcctacag
gtctatctttatcattcccttggaaaagctgagggggattatctgaagtttccaactggg
gagtatgttgcagaagagatttgtgttgctgcttctaaagcttgtggagtcacacctgtg
tatcatagtatgtttgctttaatgaatgaaacagaaaggatctggtatccacccaaccac
gtcttccatatagatgaatcaaccaggcacaatgtactctacagagtcagattttacttt
ccttactggtattgtaatggcagcaacagaacctataggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctttttgctcagtggaggcatgat
tttttgcatggatggataaaagtacctgttactcatgaaacacaggaagaatgtcttggg
atggcggtgttagatatgatgagaatagccaaagaaaaggatcagacccccctggacatc
tatagctctgtcagctacaagacatttttaccaaaatgtgttcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattgagcaattc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaaacaagcaaaccaagaaggctcaaatgaaagcaga
attgtaactattcataagcaagatggtaaaagtctagagattgaacttaggtcattaaga
gaagctttgtcttttgtgtcattaattgatggatattacaggttaactgcagatgcacat
cattatctttgtaaagaagtagcacctccaatggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgccatcagtaaattgaagaaaactggtaatcagact
ggactctatgtacttcgatgcagtcctaaggactttaataaatattttctgacttttgct
gttgagagagaaaacgtcattgaatataagcactgtttgattacaaaaaatgagaatgga
gaatacaacctcactggtactaagaagaacttcagtaatcttaaagatcttttgaattgc
tatcagatggaaactgttcgctcagacagtataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaaccaatggtatttctgatgta
ccaacctcaccaacattacagaggcataataatgtgaaccaaatggtgttccacaaaatc
agaaatgaagatttgatatttcatgaaagccttggccaaggaacttttaccaaaattttt
aaaggtgtaagaagagaagtaggagactatggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaaacatctggttttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggagtttgtaaaatttggatcactagatatatatctgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagctggcatgggcc
atgcattttctagaagaaaaaacccttattcatgggaatgtgtgcaccaaaaatattctt
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattctgcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataagcccctgagtgctttggattctcaa
agaaaactacagttttatgaaaataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattcataattgtatggattacgaaccagattttagaccttctttcagagcc
atcatacgagatcttaatagtttgtttactccagattacgaactattaacagaaaatgac
atgttacctaatatgagaataggtgccctagggttttctggtgcttttgaagaccgagac
cctacacaatttgaagagagacacttgaaatttctacagcaacttggcaagggtaatttt
ggcagtgtggagatgtgccggtatgaccctctacaagacaacactggagaggtggtggct
gtgaagaagctccagcacagtactgaagagcacctcagagactttgaaagggaaattgaa
atccttaaatccttgcaacatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggccggcgtaatctaagattaattatggaatatttaccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcataaaaaacttcttcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgagg
aatatattggtggagaatgaaaacagagttaaaataggagattttggcttaaccaaagtg
ttgccacaaggcaaagaatactacaaagtgaaagaacctggtgaaagtcccatattctgg
tatgcgccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatatattgagaagagtaaaagcccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgattgtgtttcatttgatagaa
ctcctgaagaataatggaagattaccaagaccagatggatgcccagatgagatttatgta
atcatgacagaatgctggaacaataatgtaaaccaacgcccctctttcagagacctagct
cttcgagttgatcaaataagagacagcatggctggatga

KEGG   Delphinapterus leucas (beluga whale): 111178461
Entry
111178461         CDS       T05885                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04380  Osteoclast differentiation
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04621  NOD-like receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05140  Leishmaniasis
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05212  Pancreatic cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111178461 (JAK1)
   04151 PI3K-Akt signaling pathway
    111178461 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111178461 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111178461 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111178461 (JAK1)
   04658 Th1 and Th2 cell differentiation
    111178461 (JAK1)
   04659 Th17 cell differentiation
    111178461 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111178461 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178461 (JAK1)
   05203 Viral carcinogenesis
    111178461 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111178461 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111178461 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111178461 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111178461 (JAK1)
   05161 Hepatitis B
    111178461 (JAK1)
   05160 Hepatitis C
    111178461 (JAK1)
   05171 Coronavirus disease - COVID-19
    111178461 (JAK1)
   05164 Influenza A
    111178461 (JAK1)
   05162 Measles
    111178461 (JAK1)
   05168 Herpes simplex virus 1 infection
    111178461 (JAK1)
   05163 Human cytomegalovirus infection
    111178461 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111178461 (JAK1)
   05169 Epstein-Barr virus infection
    111178461 (JAK1)
   05165 Human papillomavirus infection
    111178461 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111178461 (JAK1)
   05140 Leishmaniasis
    111178461 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111178461 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178461 (JAK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111178461 (JAK1)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111178461 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 111178461
NCBI-ProteinID: XP_022436928
UniProt: A0A2Y9P436
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTDANLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIKAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNSYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDNGNILCYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLDNKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLCSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSELLGVQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LMDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGTDSECGPFIKLSDPGIPVTVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPEEVYQLMRKCWEFQPSIRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatttaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgacgcgaatctggaggcccctgagccaggggtggaagtgctcttc
tatctgtcggacagggagcccctccggttgggcggcggagagtacacagcggaggagctg
tgcatcaaggcggcgcaggaatgctgtatatctcctctgtgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccgaatcgcaccatcaccgtcgacgacaag
atgtcactccggctccactaccggatgaggttctatttcaccaactggcacgggaccaat
gataacgagcagtcagtatggcgacattctccaaagaagcagaagaatagctacgagaaa
aaaaaagttccagatgcaacccctctccttgacgccagctcattggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcatgatattgagaacgagtgtctgggaatggccgtcctggccatctcccactat
gccatgatgaagaagatgcagttgccagaacttcccaaggacatcagctacaagcgatat
ataccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggagtttaacaacaagaccatttgtgacagcagt
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatccgaatgataatggaaacattctctgctatgaagtgatggtgactggaaat
cttggaatccagtggaggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggacaataaacacaagaaggatgaggagaaaaataaaatccgg
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctgttcccacgag
gaggccttgtcctttgtgtccctcgtggacggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggctcccccgttgatcgtccacaacatacagaatggctgt
cacggtccaatctgcacagaatatgccatcaataagttgcggcaagaaggaagcgaggag
ggaatgtacgtgctgcggtggagctgcaccgacttcgacaacatcctcatgaccgtcact
tgctttgaaaagtctgagttgctgggtgtccagaagcagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctcagaccgaagcttccccagccttggagac
ctcatgagccacctgaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgatcggatcctcaagaaa
gatattatgcagggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcatggattacaaggatgacgaaggaacttccgaagagaagagaataaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgagacaggtctcccataaacacatcgtgtacctctatggcgtttgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggagggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccctggaagttcaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagatctggtccacggaaatgtgtgcactaaaaacctcctc
ctggcccgcgagggcactgacagcgagtgcggccccttcatcaagctcagtgaccccggc
atccccgtcactgtgctgtccaggcaagagtgcatagaacgaatcccatggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggccgctgacaagtggagctttggaacc
acgctctgggagatctgctacaatggcgagatccccttgaaagacaagacactgattgag
aaagagaggttctatgaaagccggtgcaggccagtgaccccgtcttgtaaggagctagct
gaccttatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacatcgtatcagaaaaaaagcca
gcaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaggtggccgtcaaatccctgaagcctgagagcggagggaaccacatagctgat
ctgaagaaggaaattgaaatcttaagaaacctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagacggaggaaacggtattaagctcatcatggaatttctgccttca
ggaagtcttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcagtta
aaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgttcac
cgtgacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattggggac
tttggtctaaccaaagccattgaaactgataaggagtactacacagtcaaggacgatcgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttttatatcgcc
tctgatgtctggtcttttggagtaactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggcgttgttcctgaaaatgataggcccaactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacctaactgtcca
gaagaggtttatcaacttatgagaaaatgctgggaattccaaccatccattcggacaacc
tttcagaaccttattgagggatttgaagcgcttctaaaataa

DBGET integrated database retrieval system