KEGG   Delphinapterus leucas (beluga whale): 111166019
Entry
111166019         CDS       T05885                                 

Gene name
C3
Definition
(RefSeq) complement C3 isoform X1
  KO
K03990  complement component 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04080  Neuroactive ligand-receptor interaction
dle04145  Phagosome
dle04610  Complement and coagulation cascades
dle04613  Neutrophil extracellular trap formation
dle05133  Pertussis
dle05134  Legionellosis
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05150  Staphylococcus aureus infection
dle05152  Tuberculosis
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05203  Viral carcinogenesis
dle05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111166019 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111166019 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111166019 (C3)
   04613 Neutrophil extracellular trap formation
    111166019 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111166019 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    111166019 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    111166019 (C3)
   05134 Legionellosis
    111166019 (C3)
   05150 Staphylococcus aureus infection
    111166019 (C3)
   05152 Tuberculosis
    111166019 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111166019 (C3)
   05168 Herpes simplex virus 1 infection
    111166019 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166019 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111166019 (C3)
   05142 Chagas disease
    111166019 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111166019 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111166019 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111166019 (C3)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   111166019 (C3)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Phagocytosis
   Opsonins
    111166019 (C3)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111166019 (C3)
SSDB
Motif
Pfam: TED_complement MG1 A2M MG4 A2M_BRD A2M_recep NTR MG2 ANATO MG3
Other DBs
NCBI-GeneID: 111166019
NCBI-ProteinID: XP_022412952
UniProt: A0A2Y9M110
LinkDB
Position
Unknown
AA seq 1695 aa
MHPTSGPSLLLLLASLPLALGDPMYSMIIPNILRLESEETVVLEAHEGEGNIPVAVTVHD
FPSKRQVLSSENTELNSANGYLGTVTIKIPASKELKSDKGHKFVTVQAAFGNVLVEKVVL
ISLQSGYLFIQTDKTIYTPGSTVLYRIFTVDHKLLPVGQTVIVSIETPDGIPIKRDSLSS
HNQFGILALSWNIPELVNMGQWKIKAHYEDSPQQVFSAEFEVKEYGKGSREPQVGAWGRR
GEHIILGPVLAYCPPRPVPPVLPSFEVQVEPEEKFYYIDDPDGLKVNIIARFLYGENVDG
TAFVIFGVQDDDRRISLAHSLTHIPINDGTGVAKLQRQVLLNGVQPSQADALVGKSLYVS
VTVILHSGSDMVEAERTGIPIVTSPYQIHFTKTPKFFKPAMPFDLMVFVTNPDGSPARHI
PVVTQGTNVQSLTQEDGVAKLSINTLNNRQPLTITVRTRQENIPEARQATRTMQALPYNT
QGNSNNYLHLSVPRVELKPGETLNVNFHLRTDPSHQAKIRYYTYLVMNKGKLLKVGRQVR
EPGQDLVVLPMTITPDFIPSFRLVAYYTLITSNNQREVVADSVWVDVKDSCVGTLVVKNG
GKEEKHHRPGQQITLKIEADQGSRVGLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCT
PGSGSDYAGVFTDAGLALKTSKGLQTAQRTDPQCPKPAPRRRRSVQLMEKRTDKAGQYNK
ELRKCCEDGMRDNPMKFPCQRRAQFILQGDACVKAFLDCCEYIAQLRLQHSRDGTLELAR
SDLDDEIIPEEDIISRSQFPESWLWTIVEDLKGPDKNGISTKLMNVFLKDSITTWEILAV
SLSDKKGICVADPYEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYREAEELKVRVELL
YNSAFCSLATAKKRHQQTVIIPPKSSVPVPYVIVPLKVGLHEVEVKAAVYNRFISDGVKK
TLKVVPEGMRVNKTVAVRTLDPEHLGQKGVQREEIKAADLSDQVPDTESETKILLQGTPV
AQLTEDAINGERLKHLIQTPSGCGEQNMISMTPTVIAVHYLDNTEQWEKFGLEKRQESLE
LIKRGYTQQLAYRQPNSAYAAFLSRPPSTWLTAFVVKVFALASNLIAIDSQVLCGAVKWL
ILEKQKPDGVFQEDGPVIHQEMIGGFKNPEEKDVSLTAFVLIALQEAKDICEGQVNSLGR
SITKAGDFLEDHYIELQRPYTVAIAGYALALLGKLDDDLVNKFLNTATERNRWEEHGQKL
YNVEATSYALLALLVLKDFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDVP
DHKELNLDVSIQLPSRSSLIRHRIIWESASLLRSEETKENEDFTLTAQGKGQGTLSVVTV
YHAKLKGKVTCKKFDLRVSIRPAPQPVKKPQDAKASMILDICTRYLGDQDATMSILDVSM
MTGFSPDIDDLKLLSTGVDRYISKYELNKDSTKNTLIIYLDKVSHSLEDCLSFKVHQYFN
MGLIQPGAVKVYSYYNLDEVCTRFYHPEKEDGMLDKLCHKDTCRCAEENCFMHHTEDEVT
LEDRLDRACEPGVDYVYKTRLLRKELSDDFDDYIMVIEQIIKSGSDEVQVQQERRFISHI
KCREALKLKEGAHYLVWGVSSDLWGEKPNISYIIGKDTWVELWPEADECQDEENQKLCQD
LANFTENMVVFGCPN
NT seq 5088 nt   +upstreamnt  +downstreamnt
atgcatcctacctcgggtcccagtctgctgctgctgctggccagtctccccctggccctg
ggggaccccatgtattccatgatcatccccaacatcctgcgtctggagagcgaggagacg
gtggtgctggaggcccacgaaggggaagggaatataccagtcgccgtcactgtccacgac
ttcccgtccaagagacaagtgctgtccagcgaaaacaccgagctgaacagtgccaatggc
tacctgggcaccgtcaccataaagatcccggccagcaaggagttaaaatcagacaagggg
cacaaattcgtgactgtccaggcggccttcgggaacgtcctggtggagaaggtggtgctg
ataagccttcagagtgggtacctcttcatccagacggacaagaccatctacaccccaggc
tccacggtcctgtatcggatctttaccgttgaccacaagctgctgcccgtgggccagaca
gttatcgtcagcattgagacccccgatggcattcccatcaagcgggactccctgtcttct
cacaaccagtttggcatcttggccttgtcttggaacatcccagagctggtcaacatgggg
cagtggaagatcaaagcccactacgaagattctccgcagcaggtcttctctgctgagttt
gaggtgaaggaatacggtaaggggagcagggagccgcaggtgggagcgtggggaaggagg
ggggagcacataattctgggcccagtgctggcttactgcccaccacgacctgttccccca
gtgctgcccagttttgaggtccaagtggagcctgaagagaaattctactacatcgatgac
ccagatggcctgaaagtcaacatcattgccaggttcttgtacggggagaatgtggatgga
acagctttcgtcatctttggagtccaggatgatgaccggaggatttcattggcccactcc
ctcacccatattccgatcaatgacggtactggggtggccaaactgcaacgacaggtcttg
ctgaacggggtacagccctcccaagccgatgccctagtgggcaagtccttatatgtgtct
gtcaccgtcatcctgcactcaggcagcgacatggtggaggcagagcgtaccgggatcccc
atcgtgacctccccctaccagatccacttcaccaagacccccaagttcttcaaacccgcc
atgcccttcgacctcatggtgttcgtgacgaaccccgacggctcccctgcccgccacatc
ccagtggtgacccagggcaccaatgtgcagtccttgacccaggaggacggtgtggccaag
ctgagcatcaacacactcaacaaccggcagcccctgaccatcaccgtacgcacacggcag
gagaatatcccagaggcacgacaggccactaggaccatgcaggccctaccctacaacacc
cagggcaactccaacaattacctgcacctctctgtgccccgagtggagctcaagcctggg
gagactctcaatgtcaacttccacctgcgcacggaccccagccaccaagccaagatccgc
tactacacttacttggtcatgaacaaggggaagctgttgaaggtggggcggcaggtgcga
gagcccggccaggacctggtggtgttgcccatgaccatcacaccggacttcatcccttcc
ttccgcctggtggcctattacacgctgatcaccagcaacaaccagagggaggtggtggcc
gactccgtgtgggtggatgtcaaggactcatgtgtgggcacgctggtggtgaaaaatggc
gggaaggaagagaagcaccataggcctgggcaacagataaccctgaagatcgaggctgac
caggggtcccgagtggggctggtggccgtggacaagggcgtgtttgtgctgaataagaag
aacaaattgacccagagtaagatctgggacgtagtggagaaggcagacattggctgtacc
ccaggcagtggaagtgactatgccggcgtcttcacggatgcagggctggccctcaagacc
agcaaaggcttacagaccgcccagaggacagatcctcagtgtccgaaaccagccccccgc
cgacgccgctcggtgcagctcatggaaaagaggacggataaagccggtcagtacaacaag
gagctgcgcaagtgctgtgaggacggcatgcgggacaaccccatgaagttcccgtgccag
cgccgggcccagttcatcctgcaaggcgacgcatgcgtgaaggcctttctggactgctgt
gaatacatcgcccagctgcggctgcagcacagccgcgacgggacactggagctggccagg
agtgacctggatgatgaaataatcccggaggaggacatcatttcccgaagccagttccca
gagagctggctgtggaccattgttgaggaccttaaaggcccagacaaaaatggaatctcc
acgaagctcatgaacgtgtttttgaaagactccatcaccacttgggagattctggctgtg
agcttgtcagacaagaaagggatctgtgtggctgacccctatgaggtcacggtgatgcag
gatttcttcattgacctgcgtctaccctactctgttgtgcgcaatgagcaggtggagatc
cgagctgtcctctacaactaccgggaggcggaggagctcaaggtgagggtggaattgctc
tacaattcagccttctgtagcctggcaactgccaagaagcgccaccagcagactgtaatc
atcccacccaagtcctcggtgcccgtgccttatgtcatagtgcccctgaaggtcggcctc
catgaggtggaggtcaaggctgctgtctacaaccgcttcatcagtgatggtgtcaagaag
accctgaaggtcgtgccagaaggaatgagagtcaacaaaactgtggctgtccgcacactg
gatccagaacatctgggacaaaagggagtgcagcgagaggaaatcaaagctgccgatctc
agtgaccaagtcccagacacggagtcagagaccaagatcctcctgcaagggaccccagtg
gcccagttgacagaggacgccatcaacggggagcggctgaagcacctcatccaaaccccc
tcgggctgtggggagcagaacatgatcagcatgacgcccacggtcatcgcggtgcactac
ctggacaacacagaacagtgggagaagttcggcctggagaagcggcaggagtccttggag
ctcatcaagagggggtacacccagcagctggcctacagacaacccaactcggcttacgcc
gccttcctgagccggccacccagcacctggctgacagccttcgtggtcaaggtcttcgca
ctggcctccaacctcatcgccatcgactcccaggtcctctgtggggccgtcaaatggctg
atcctagagaagcagaagcctgatggagtcttccaggaggatgggcccgtgatacaccaa
gaaatgattggtggcttcaagaatcccgaggagaaagacgtgtccctcacggcgtttgtt
ctcatcgcgctgcaggaggctaaagacatttgcgagggacaggtcaacagcctggggcgc
agcatcactaaggcaggagacttccttgaagaccactacatagagttgcaaaggccatat
actgtggccattgctggctacgccctggctctgttgggcaagctggatgatgacctcgtc
aacaaatttctgaacacagccacagaaaggaaccgctgggaggagcatggccagaagctc
tacaacgtggaagccacatcctacgccctcttggctctgctggtgctcaaagactttgac
tctgtgcctcctgttgtgcgctggctcaatgagcagagatactacggaggtggttacggc
tccacgcaggccactttcatggtgttccaagccttggcccagtaccagaaggatgtccct
gatcacaaggagctgaacctggatgtgtccatccaactacccagccgcagctctctgatc
aggcatcgtatcatctgggaatctgctagcctcctgcgctcagaagagaccaaggaaaat
gaggatttcacattaacagctcaagggaaaggacagggtaccttgtcggtggtgaccgtg
taccacgccaaactcaaaggcaaagtcacctgcaaaaagtttgacctccgggtttccata
cgtccagccccccaaccagtcaagaagcctcaggacgccaaagcctccatgatccttgac
atctgtacaaggtacctgggagaccaggatgccactatgtcaatcctggatgtatccatg
atgacgggcttctctcctgatattgatgacctcaaactgctgagcactggtgtcgacaga
tacatctctaagtatgagctgaacaaagactccacaaagaacaccctcatcatctacctg
gacaaggtctcacacagcctggaggactgtctatccttcaaagttcaccagtactttaac
atggggctcatacagcctggggcagtcaaggtgtactcttattacaacctggatgaagtt
tgcacccggttctaccacccggagaaggaggacgggatgctggacaaactctgccacaaa
gatacatgccgctgtgctgaggagaactgcttcatgcaccacacggaggacgaggtcacc
ctggaggaccggctggacagggcctgcgagccgggcgtggactatgtgtacaagaccaga
cttctcaggaaggagctgtcggatgactttgacgattacatcatggtcatcgagcagatc
atcaaatcaggttccgatgaggtgcaagttcaacaggagcgtaggttcatcagtcacatc
aagtgcagagaagccctcaaactgaaggagggggcccactacctcgtgtggggcgtctcc
tctgacctgtggggagagaaacccaacatcagctacatcatcgggaaggacacctgggtg
gagctgtggcctgaagcggatgaatgccaagacgaggagaaccagaaactgtgccaggac
ctggccaacttcaccgaaaacatggtggtctttggctgccccaactga

DBGET integrated database retrieval system