KEGG   Delphinapterus leucas (beluga whale): 111166027
Entry
111166027         CDS       T05885                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4 isoform X1
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04630  JAK-STAT signaling pathway
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111166027 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166027 (PIAS4)
   04064 NF-kappa B signaling pathway
    111166027 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111166027 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111166027 (PIAS4)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111166027 (PIAS4)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111166027 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CENP-B_dimeris Sporozoite_P67
Other DBs
NCBI-GeneID: 111166027
NCBI-ProteinID: XP_022412963
UniProt: A0A2Y9M6G9
LinkDB
Position
Unknown
AA seq 520 aa
MRVHEAAPDGPNLVEGNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPE
LFKKIKELYETRYAKKSSEPVPQPHRPLDPLTMHSTYDRASSVPRTPLTGPNIDYPVLYG
KYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQV
ELIRNSRELQPGVKAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPG
VEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGV
KHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFY
LQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKER
SCSPQCPILVLGTSDANGLPTTPNVNGGGGSALGGAGGGGSAAGGVENGKPGADVVDLTL
DSSSSSEEDEDEDEEDEDEDEDGPRPKRRCPFQKGLVSAC
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcgcgtgcatgaggcggctccggatggccccaacctggtggaagggaacatggtgatg
agtttccgagtctctgatcttcagatgctcctgggttttgtcggccggagtaagagcgga
cttaaacacgaacttgtcacccgggctctccagctggtccagtttgactgtagtcccgag
ctgttcaagaagatcaaggagctctacgagacacgctacgccaagaagagctcggagccc
gtgccgcagccccaccggcccttggaccccctgaccatgcactccacctacgaccgggcc
agctcggtgcccaggactcccctcacgggccccaacattgactaccccgtgctctacggg
aagtacttaaacggactcggacggttgcctgccaagaccctcaagccagaagtgcgcctg
gtgaagttgcccttctttaacatgttggatgaattgctgaagcccaccgagctggttcca
cagaataacgagaagcttcaggagagcccgtgcatctttgccttgacgcccagacaggtg
gagctgatccggaactccagagaactgcagcccggggtcaaggccgtgcaggtcgtccta
agaatctgctattcagacaccagcagccctcaggaagaccagtacccacccaacatcgcc
gtgaaggtcaaccacagctactgctcggtcccgggctactacccctcgaacaagccagga
gtggagcccaagaggccgtgccgccccattaacctcacccacctcatgtacctgtcctcg
gccaccaaccgcatcaccgtcacctgggggaactacggcaagagttactccgtggccttg
tacttggtgcggcaactgacctcctcggagctgctgcagaggttgaagaccatcggggtc
aagcacccggagctgtgcaaggcactggtcaaagagaagctgcgcctggaccccgacagt
gagattgccaccactggcgtgcgggtctccctcatctgcccgctggtgaagatgcggctg
tcggtgccctgccgcgcggagacctgcgcacacctgcagtgcttcgacgccgtcttctac
ctccagatgaacgagaagaagcccacctggatgtgcccggtgtgtgacaagccagccccc
tacgaccagctcatcatcgatgggctcctctccaagatcctgagcgagtgcgaggatgcc
gatgagatcgagtacctggtggacggctcgtggtgcccgatccgtgccgagaaggagcgc
agctgcagcccccagtgccccatccttgtgcttggcacctcggatgctaatgggctccca
accacccccaacgtcaacggtgggggtggcagcgcgctcgggggcgcgggcggcgggggc
agcgcggcgggaggcgtggagaacgggaagccaggagctgatgtggtggacctcacgctg
gacagctcgtcgtcctcggaggaggacgaggacgaggacgaggaggacgaggacgaggac
gaggacggcccccggcccaagcgtcgctgccccttccagaagggcctggtgtcggcctgc
tga

KEGG   Delphinapterus leucas (beluga whale): 111168224
Entry
111168224         CDS       T05885                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111168224 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168224 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111168224 (PIAS2)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111168224 (PIAS2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111168224 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 111168224
NCBI-ProteinID: XP_022417535
UniProt: A0A2Y9M731
LinkDB
Position
Unknown
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIETAGVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSS
SRSETGVITSSGSNIPDIISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagttttagggtttctgaactacaa
gtgttactaggctttgccggaaggaataaaagtggacgcaagcatgacctcctgatgagg
gcgttgcatttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatacccacggactcttgaaggcctttctgatttatccacaatcaaatca
tcggttttcagtttggatggtagctcctcacctgtagaacctgacttggctgtggctgga
atccactcgttgccttccacttcagttacacctcactcgccgtcctctcctgttggttct
gtgctgcttcaagatactaaacccacgtttgagatgcagcagccatctcccccaatccct
cctgttcatcctgatgtgcagttaaaaaacttacccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcaacggtttcaagagaagttttttatt
tttgctctgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacgagttgc
cctcaagaagataactatcccaatagtctctgtataaaagtaaatgggaagctgtttcct
ttgcctggctatgcaccaccacctaaaaatgggattgagcagaagcgccctggacgccct
ttgaatattacatctttagttagattatcctcagctgtgccaaaccagatttccatttct
tgggcgtcagaaattggaaagaattactccatgtctgtatatcttgtacgacagctcaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcggatcctgatagtgaaattgctaccactagcctt
cgggtgtccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctacagtgctttgatgctgccctttatctgcaaatgaatgagaagaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaattttagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaagaa
gatggttcttggtgcccaatgagaccgaagaaagaagctatgaaagtatccagccaacca
tgtacaaaaatagaaactgcaggtgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtggatgtcattgacctaacaatagaaagctcttctgatgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccacacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagc
agtacgtctgtcaccaccaccagcccccatgaaagcagtactcatgttagttcatccagc
agcaggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctca
ttggactaa

KEGG   Delphinapterus leucas (beluga whale): 111177755
Entry
111177755         CDS       T05885                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1 isoform X1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04630  JAK-STAT signaling pathway
dle05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111177755 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111177755 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    111177755 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111177755 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111177755 (PIAS1)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111177755 (PIAS1)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111177755 (PIAS1)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    111177755 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 111177755
NCBI-ProteinID: XP_022435578
UniProt: A0A2Y9P0C8
LinkDB
Position
Unknown
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSISSVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKSKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPATNGSSSGSNSSLVSSNSLRESHSHTVANRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgcagtcctgctgtacaaatgaaaattaaagaactc
tataggcggaggttcccccagaaaatcatgacgcctgcggacttgtccatctccagcgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttatgat
ggtcaccctgcatcatcaccgttactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agccagcgctttcgagaaacctgttttgcatttgcattgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgc
gtgaaagtgaatacaaaaccttgcagccttccaggttatcttccacctactaaaaatggt
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgattgtccaca
actgtaccaaacaccattgttgtttcatggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaaattgactgcggatcca
gacagtgaaatagctacaaccagcctgagggtttctctactatgtccacttggtaaaatg
cggttgacaattccatgtcgggcccttacatgttctcatctgcagtgttttgatgcaact
ctttatattcagatgaatgagaaaaaaccaacttgggtttgccctgtctgtgataagaag
gctccgtatgaacaccttattattgatggcttgtttatggaaatcctgaagtactgtaca
gattgtgatgaaatacagtttaaggaggatggctcttgggcacctatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggggttgacggatgcttgagctccacatta
gagcaccaagtggcttctcatcaccagtcctcaaataaaagtaagaaagtagaggtgatt
gacctaaccatagacagttcatctgatgaagaggaggaagagccatctgccaagagaacc
tgcccttctctctctcccacatcaccactaagtaataaaggcatattaagtcttccacat
caagcatctccagtgtcccgcaccccaagcctccctgctgtagacacaagctatattaac
acatccctcatccaagactacagacatcctttccacatgacacccatgccttatgacttg
caaggattagatttctttcctttcttatcaggagacaatcagcattataacacctccctg
cttgctgctgcagcagcagcggtttcagatgatcaagacctcttacactcgtctcggttt
tttccatatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccagccaccaatggaagcagcagtggcagtaacagcagcctcgtatcctccaacagc
ctaagggagagccatagccacaccgtcgcaaataggagcagcacggacacagcatccatc
ttcggcatcataccagacattatttcattggactga

KEGG   Delphinapterus leucas (beluga whale): 111179937
Entry
111179937         CDS       T05885                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111179937 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111179937 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111179937 (PIAS3)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     111179937 (PIAS3)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   111179937 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 111179937
NCBI-ProteinID: XP_022439578
UniProt: A0A2Y9PAY8
LinkDB
Position
Unknown
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEIYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLGPTLGSSHRSTTPAPPPGRVSSIVAPG
GNLREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctcctcggcttcgctggccggaacaagagtggacggaagcacgagctcctggccaag
gccctgcacctcctcaagtccagctgtgcccccagcgtccagatgaagatcaaagagctt
taccgccgacgctttccccggaagaccctggggccctccgatctttctctgctctctctg
ccccctggcacccctcctgtaggctctcctggtcctctagctcccatccccccagccctc
ttggcccctggcaccctgctgggccccaagcgtgaagtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaaatctacggggag
ctcatccggcccaccaccctcgcatccacttctagccagcggtttgaggaagcgcacttc
acctttgccctcactccccagcaagtgcagcagattctcacatccagagaggttctgcca
ggagcgaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaagaggattacttcccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttccccctaccaagaatggggctgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcggccactgttcccaacaccatcgtggtc
aactggtcgtctgagtttggacggaattactccttgtctgtgtacctggtgaggcagctg
actgcaggaacccttctacaaaaactcagagcaaagggcatccggaacccagaccattcc
cgggcactgatcaaggagaagctgaccgctgacccggacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcttgactgtcccttgtcgggcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagccaacgtggacatgtcctgtgtgtgataagaaggctccctatgaatctcttatcatt
gatggtttattcatggagattcttaattcctgctcggattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtccaagagggcaatccatcagag
aataagaagaaggttgaagttattgacttgacaatagaaagctcatcagacgaggaggac
ctgcccccgacgaagaagcactgtcctgtcacttcagctgctatcccagctctacctgga
agcaaaggagtcctgacatctggtcaccagccatcttcggtgctacggagccctgctatg
ggcacgctgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggggctgatatccaaggtttagatttattttctttccttcagactgagagtcag
cactatggtccatccgtcatcacctcgctagacgaacaggatgccctgggccacttcttc
cagtaccgagggaccccttcccacttcctgggcccgctaggccccacgttggggagctct
caccgcagcaccactccggcaccccctcctggccgtgtcagtagcattgtggcccctggg
ggaaacttaagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system