KEGG   Delphinapterus leucas (beluga whale): 111166195
Entry
111166195         CDS       T05885                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111166195 (CREB3L3)
   04024 cAMP signaling pathway
    111166195 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    111166195 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    111166195 (CREB3L3)
   04152 AMPK signaling pathway
    111166195 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111166195 (CREB3L3)
   04922 Glucagon signaling pathway
    111166195 (CREB3L3)
   04915 Estrogen signaling pathway
    111166195 (CREB3L3)
   04926 Relaxin signaling pathway
    111166195 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    111166195 (CREB3L3)
   04918 Thyroid hormone synthesis
    111166195 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    111166195 (CREB3L3)
   04916 Melanogenesis
    111166195 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    111166195 (CREB3L3)
   04927 Cortisol synthesis and secretion
    111166195 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111166195 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111166195 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    111166195 (CREB3L3)
   04728 Dopaminergic synapse
    111166195 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    111166195 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    111166195 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111166195 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    111166195 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111166195 (CREB3L3)
   05020 Prion disease
    111166195 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    111166195 (CREB3L3)
   05031 Amphetamine addiction
    111166195 (CREB3L3)
   05034 Alcoholism
    111166195 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111166195 (CREB3L3)
   04934 Cushing syndrome
    111166195 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166195 (CREB3L3)
   05161 Hepatitis B
    111166195 (CREB3L3)
   05163 Human cytomegalovirus infection
    111166195 (CREB3L3)
   05165 Human papillomavirus infection
    111166195 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111166195 (CREB3L3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111166195 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 DUF1664
Other DBs
NCBI-GeneID: 111166195
NCBI-ProteinID: XP_022413317
UniProt: A0A2Y9M7G3
LinkDB
Position
Unknown
AA seq 457 aa
MNGDLAVGKMASSTSLTCPTDSLELLDLLFDRQDGILRHIELGEDWGHVEDQVLPGPNSD
DFLNSILGSGESVPSSPTWSPAASDSGISEDLPSDPQDTPPHSGVVATPASCHSAESGKG
PCPSYHTGPACPTRNLGPVAQGFEASVAIDLEMWSPGLYAGEQAELANSPPHCNLTVKDL
LLSGSGGDLQHHLAAPNLLRLGTEHSQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
KLQAIVVQSTSKSAQTGTCIAVLLFSFALIILPSISPFASNKAESPGDFVPVRVFSRTLH
NDAASRVAPNTVPGSETPGHGPKAGTLQEGSPSSPQGEWGSRDPPAPDNSTEDLDNGTLV
QGNSMKELDRAALLDCARPEQALGPGRVGLEVAVGEL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaatggggatttagcagttggaaagatggcttcctccaccagtctcacgtgccctacc
gacagcctggaactcttggatctcctgtttgaccggcaggacggcatcctgagacacata
gagctgggcgaggactggggccacgttgaggaccaggtcctgccaggcccgaactctgat
gatttcctcaactccatcctgggttctggagaatcagtgcccagctccccgacctggtct
cctgcggccagtgacagtggcatctcagaagatctgccctccgacccccaggacacccct
ccacacagtggggtggttgccaccccggccagctgccatagcgcagagtctggcaagggg
ccctgcccctcctaccatactggccctgcctgccccaccaggaaccttgggccagtggcc
caagggtttgaggcttccgttgctatagacctggaaatgtggagcccaggcctgtacgcc
ggggagcaggctgagctggccaactcacccccgcactgcaacctcacagtgaaagacctc
ctcctctctggcagtggcggggacttgcaacatcacctggcagccccaaacctgttgcgc
cttgggaccgagcacagccaggagctggtgctgacagaggatgagaagaagctgttggcc
aaagaaggcatcaccctgcccacccagcttcccctcaccaagtatgaggagcgagtgctg
aagaaaatccgccggaaaattcggaacaaacagtcagcccaagaaagccggaaaaagaag
aaggaatatattgatggcctggaaactcggatgtcagcctgcactgcccagaaccaggaa
cttcagaggaaggtcttgcatcttgagaagcagaacctgtccctcttggagcagctgaag
aaactccaggccatcgtggtccagtccaccagcaagtcggctcagacgggcacctgcata
gcggtcctgctcttctccttcgccctcatcatcctcccctccatcagccctttcgcctcc
aacaaagctgagagccctggagacttcgtgcctgtacgagttttctccagaactttgcac
aacgatgctgcatcccgtgtggctcccaacaccgtgccaggctccgaaaccccaggacat
gggcccaaggctggcacacttcaggaagggtctccaagcagccctcagggggaatgggga
tcccgggacccgccggctccggacaactcgacggaggatctggacaacgggaccctggtc
cagggcaactccatgaaggagctggaccgggccgccctcctagactgtgcccggcctgaa
caagcacttggcccagggcgcgtggggctggaggtagcagtgggggagctgtga

KEGG   Delphinapterus leucas (beluga whale): 111167181
Entry
111167181         CDS       T05885                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111167181 (CREB3L4)
   04024 cAMP signaling pathway
    111167181 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    111167181 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    111167181 (CREB3L4)
   04152 AMPK signaling pathway
    111167181 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111167181 (CREB3L4)
   04922 Glucagon signaling pathway
    111167181 (CREB3L4)
   04915 Estrogen signaling pathway
    111167181 (CREB3L4)
   04926 Relaxin signaling pathway
    111167181 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    111167181 (CREB3L4)
   04918 Thyroid hormone synthesis
    111167181 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    111167181 (CREB3L4)
   04916 Melanogenesis
    111167181 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    111167181 (CREB3L4)
   04927 Cortisol synthesis and secretion
    111167181 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111167181 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111167181 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    111167181 (CREB3L4)
   04728 Dopaminergic synapse
    111167181 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    111167181 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    111167181 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111167181 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    111167181 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111167181 (CREB3L4)
   05020 Prion disease
    111167181 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    111167181 (CREB3L4)
   05031 Amphetamine addiction
    111167181 (CREB3L4)
   05034 Alcoholism
    111167181 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111167181 (CREB3L4)
   04934 Cushing syndrome
    111167181 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111167181 (CREB3L4)
   05161 Hepatitis B
    111167181 (CREB3L4)
   05163 Human cytomegalovirus infection
    111167181 (CREB3L4)
   05165 Human papillomavirus infection
    111167181 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111167181 (CREB3L4)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111167181 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4200 HAUS-augmin3 EMP24_GP25L DUF1664 DUF724
Other DBs
NCBI-GeneID: 111167181
NCBI-ProteinID: XP_022415425
UniProt: A0A2Y9M138
LinkDB
Position
Unknown
AA seq 443 aa
MDFRTPDLLEMWLEPPEDVFSTGSFLELGLHGPPSEVPVTRLQEQGLQGWESSGGHGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPRHPDSPPAPRPPSSPALYEAVYEAG
TLERMQGEAGPAVGLISIQIGQCSLWEADNGPSGPALTLGLREFPQPVPLPRACGHPSPF
SQPPMFPSDQSSPPFMVPDACVVSELPPDAHAHILPRAGTVNSVPPAALLPCQTLLLTEE
EKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAAC
SAQNQELQKKVQELERHHTSLVTQLRQLQMLIVHTSNKAAQTSTCALILLFSLALIILPS
FSPFQGLPEAGPEDYQPHGVISRNILTHKDMTENLENPAVESRLEGPPGAKGVNGSTRTL
LEKTGGRAGPSRHIRTVLHADEM
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatttcagaacccctgacctgctggaaatgtggctggagcctccagaagacgtcttc
tcaacaggatccttcctggagctgggactccatggtccaccttcagaggtcccagtaact
aggctacaggaacaggggctgcaaggctgggagtccagtgggggccatggctgtggtctt
caagagagcgagcctgaagatttcctgaaacttttcattgatcccaatgaagtatactgc
tcagaagcatctcctggcagtgacagtggaatctctgaggatcctcgccatccagacagt
ccccctgcccccaggccacccagttcccctgccctctatgaggctgtctatgaggcaggg
accctagagaggatgcagggggaagctgggccagctgtagggctcatctccatccaaata
ggtcagtgttctttgtgggaagcggacaatggcccttcaggtccagccctaaccctgggg
ttaagggagtttccccaacctgtgccactacccagggcctgcggccatccatctcctttc
tcccagccacctatgtttccctcagatcagtcgagcccaccatttatggtgcctgatgcc
tgtgtggtcagtgagctgcctcccgatgctcatgcccacatcctgcccagagcaggcact
gtaaactcagtgcctcctgcagccctgctgccctgtcaaaccttgctcctgacagaagag
gagaagcgtctgctgggacaggaaggggtgtccctaccctctcacctgcccctcaccaag
gcagaggagagggtcctcaagaaggtcaggaggaaaatccgtaacaagcagtcagctcag
gacagtcggcggcggaagaaggagtacatcgatggactagagagcagggtggctgcctgt
tctgcacagaaccaggaactacagaaaaaagtccaggagctggagaggcaccacacctcc
ctggtgactcagctccgccagctgcagatgctcattgttcacacctccaacaaagccgcc
cagactagcacttgtgctctgatccttcttttctccttggctctcatcatcctgcccagt
ttcagcccctttcagggattaccagaagctgggcctgaggattaccagcctcatggagtg
atttccagaaacatcctgactcacaaggacatgacagaaaatctggagaatccagcggtg
gagtccagattggaggggccacctggggccaagggtgtaaatggctcaacaaggacactg
cttgagaagacaggagggagggcaggccccagcaggcacatcagaactgtgttgcatgca
gatgaaatgtga

KEGG   Delphinapterus leucas (beluga whale): 111170946
Entry
111170946         CDS       T05885                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04141  Protein processing in endoplasmic reticulum
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04918  Thyroid hormone synthesis
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111170946 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111170946 (ATF6B)
   04022 cGMP-PKG signaling pathway
    111170946 (ATF6B)
   04151 PI3K-Akt signaling pathway
    111170946 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111170946 (ATF6B)
   04915 Estrogen signaling pathway
    111170946 (ATF6B)
   04926 Relaxin signaling pathway
    111170946 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    111170946 (ATF6B)
   04918 Thyroid hormone synthesis
    111170946 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    111170946 (ATF6B)
   04925 Aldosterone synthesis and secretion
    111170946 (ATF6B)
   04927 Cortisol synthesis and secretion
    111170946 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111170946 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    111170946 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    111170946 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111170946 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    111170946 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    111170946 (ATF6B)
   05031 Amphetamine addiction
    111170946 (ATF6B)
   05034 Alcoholism
    111170946 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111170946 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111170946 (ATF6B)
   05161 Hepatitis B
    111170946 (ATF6B)
   05163 Human cytomegalovirus infection
    111170946 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111170946 (ATF6B)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111170946 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 111170946
NCBI-ProteinID: XP_022422284
UniProt: A0A2Y9MJD1
LinkDB
Position
Unknown
AA seq 700 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDEVAEEQTRLFLCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPSSSSSLSSESSRLSAEPSSQASGVGEVLV
VKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDASDVQIKIEPVSPSSSINSEASLLSA
ESPNQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGKPLPARKPP
LQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGLTPPAPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAP
ISPRMSREEPRPQRHLLEFSAQEPVHRVEHPQHPSQGPKETQPSSTGQPSFRNLTAFPGG
TKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRPQERQKSQLW
KKSPPVKAVPTQPPGPPERDAVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSSPGNATGGPLPASAASQAHQAARQPXYLNHP
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacgcgctttttcaccgacaat
ttgctgagcccggaggactgggacagcaccttatacaccggcctggatgaagtggccgag
gagcagacgcggctcttcctttgcccggagcaggatgtcccgtttggcagcagttccctg
gacttggggatggatgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatcttcaggtgaagtctgagccatcctccccctcctcttcctcctccctcagctctgaa
tcctcgcgcctttctgcagagccctccagccaggcctctggtgtaggggaggtgctggtc
gtgaagtcagagtccttgacaccctcactctgcctcttgggagatgatccaacatcccca
tttgaaaccgtccagatcaatgtgggccccacctctgatgatgcctcagatgtccagatt
aagatagagcctgtctctccatcttcctccatcaactcagaggcttccctgctctctgcg
gagtcccccaaccaggcttttataggagaggaggtactggaagtgaagacagagtcccca
tcccctcaagggtgtctcttgcgggatgtctcaggccccccacttggagctgtccagatc
agcatgggcctgtcctctgatggctcctcaggcaaacccctgcccgcccggaagccacca
ctgcagcccaaacctgtggtgataaccactgtcccgatgccaccgagagctgtgcctccc
agcaccactgtccttttgcagccccttgtccagccacccccagtgtccccagttgttctc
atccaaggtgctattcgagtccagcctgagggactgaccccccctgctccacggcctgag
aggaagagcattgttccagctcctatgcctgggaactcctgcccgcctgaggtggatgca
aagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtcccgg
aggaagaagaaggagtatctgcaggggctggaagctcggctgcaggctgtgctggccgac
aaccagcagctccggcgggagaatgctgccctccgccggcggctggaggccctgctggct
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttc
cttctcttcattgccttcaactttgggcctgtcagcatcagtgagcctcctccagctccc
atctctcctcggatgagcagagaggagcctcgaccccagagacacttgctggagttctcg
gcgcaagagccagttcacagagtcgagcacccccagcatccctcccagggtcccaaggag
acccagcccagctccacgggccagccaagtttcaggaacctgacagccttccctgggggc
accaaggagctgctgctgagagacctggaccagctcttcctctcctctgattgccggcac
ttcaacagaaccgagtccctgaggcttgctgatgagctgagcggctgggtccagcgccac
cagagaggccggcggaagatgccccagaggccccaggagagacagaagtctcagctatgg
aagaagtcgcctccagttaaggcagtccccacccaaccccctgggcccccagaaagggat
gctgtgggccagctgcagctatatcgtcaaccagaccgttcgcagccagagttcctggat
gcaattgaccgacgggaagacacattttatgttgtctccttccgaagggaccacttgctg
ctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcccgcc
atggcccccaatgagaccgtgtcaggccgggggcccccgggagactatgaggagatgatg
cagatcgagtgtgaggtcatggacaccagggtgatccacatcaagacctccacggtgccc
ccctcactccgaaaacagccgtcctcaagcccgggcaatgccacaggtggccccttgcca
gcttctgcagccagccaggcccaccaggccgcccgtcagcccntctacctcaatcatccc
tga

KEGG   Delphinapterus leucas (beluga whale): 111171769
Entry
111171769         CDS       T05885                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04380  Osteoclast differentiation
dle04612  Antigen processing and presentation
dle04668  TNF signaling pathway
dle04710  Circadian rhythm
dle04713  Circadian entrainment
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04924  Renin secretion
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111171769 (CREB1)
   04024 cAMP signaling pathway
    111171769 (CREB1)
   04022 cGMP-PKG signaling pathway
    111171769 (CREB1)
   04151 PI3K-Akt signaling pathway
    111171769 (CREB1)
   04152 AMPK signaling pathway
    111171769 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111171769 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    111171769 (CREB1)
   04922 Glucagon signaling pathway
    111171769 (CREB1)
   04915 Estrogen signaling pathway
    111171769 (CREB1)
   04926 Relaxin signaling pathway
    111171769 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    111171769 (CREB1)
   04918 Thyroid hormone synthesis
    111171769 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    111171769 (CREB1)
   04916 Melanogenesis
    111171769 (CREB1)
   04924 Renin secretion
    111171769 (CREB1)
   04925 Aldosterone synthesis and secretion
    111171769 (CREB1)
   04927 Cortisol synthesis and secretion
    111171769 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111171769 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111171769 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    111171769 (CREB1)
   04728 Dopaminergic synapse
    111171769 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111171769 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    111171769 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    111171769 (CREB1)
   04713 Circadian entrainment
    111171769 (CREB1)
   04714 Thermogenesis
    111171769 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111171769 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    111171769 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111171769 (CREB1)
   05020 Prion disease
    111171769 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    111171769 (CREB1)
   05031 Amphetamine addiction
    111171769 (CREB1)
   05034 Alcoholism
    111171769 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111171769 (CREB1)
   04934 Cushing syndrome
    111171769 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111171769 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111171769 (CREB1)
   05161 Hepatitis B
    111171769 (CREB1)
   05163 Human cytomegalovirus infection
    111171769 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171769 (CREB1)
   05165 Human papillomavirus infection
    111171769 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111171769 (CREB1)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111171769 (CREB1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111171769 (CREB1)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    111171769 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 111171769
NCBI-ProteinID: XP_022423227
UniProt: A0A2Y9MW12
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctacccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaaccgat
tcccaaaaacgaagagaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccgggtactacc
atcctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagattcgcacagcacccactagc
accattgcccctggagttgttatggcgtcctccccagcacttcctacacaacctgctgaa
gaagcagcacgaaagagagaggttcgcctcatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggcagtgcttgaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Delphinapterus leucas (beluga whale): 111172890
Entry
111172890         CDS       T05885                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111172890 (ATF2)
   04668 TNF signaling pathway
    111172890 (ATF2)
   04022 cGMP-PKG signaling pathway
    111172890 (ATF2)
   04151 PI3K-Akt signaling pathway
    111172890 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111172890 (ATF2)
   04922 Glucagon signaling pathway
    111172890 (ATF2)
   04915 Estrogen signaling pathway
    111172890 (ATF2)
   04926 Relaxin signaling pathway
    111172890 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    111172890 (ATF2)
   04918 Thyroid hormone synthesis
    111172890 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    111172890 (ATF2)
   04925 Aldosterone synthesis and secretion
    111172890 (ATF2)
   04927 Cortisol synthesis and secretion
    111172890 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111172890 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    111172890 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    111172890 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    111172890 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111172890 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    111172890 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    111172890 (ATF2)
   05031 Amphetamine addiction
    111172890 (ATF2)
   05034 Alcoholism
    111172890 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111172890 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111172890 (ATF2)
   05161 Hepatitis B
    111172890 (ATF2)
   05163 Human cytomegalovirus infection
    111172890 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111172890 (ATF2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111172890 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 111172890
NCBI-ProteinID: XP_022425788
UniProt: A0A2Y9N962
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIVR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLTQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSSEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgtactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaaggttcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatctcctcttgcaacacccattgtaaga
agcaaaattgaggagccctctgttgtagaaaccactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattgacacaaactgcacagcccaca
tcagctatcgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacacag
gcaccgtcctccaacaggccaatcgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttcgaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccggga
attccaggtccttcctctcctcagccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggcgatactgtcaaaggtcatggtagc
ggactggttaggactcaatcagaggaatctcgaccacagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaaatacaact
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaagaaggaagtttctggaa
agaaatagagcagcagcttcaagatgcagacaaaaaagaaaagtctgggttcagtcttta
gaaaagaaagcagaagacttgagttcattaaatggtcaattgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
ctgtcagtgccgagtagtccacatactgaagctatacagcatagttctgtcagcacgtcc
aatggagtcagctcaacttccaaggcagaagctgtagccacttcagtcctcacgcagatg
gcggaccagagttcagagcctgcgctttcacagattgtcatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Delphinapterus leucas (beluga whale): 111177962
Entry
111177962         CDS       T05885                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111177962 (CREB3L2)
   04024 cAMP signaling pathway
    111177962 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    111177962 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    111177962 (CREB3L2)
   04152 AMPK signaling pathway
    111177962 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111177962 (CREB3L2)
   04922 Glucagon signaling pathway
    111177962 (CREB3L2)
   04915 Estrogen signaling pathway
    111177962 (CREB3L2)
   04926 Relaxin signaling pathway
    111177962 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    111177962 (CREB3L2)
   04918 Thyroid hormone synthesis
    111177962 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    111177962 (CREB3L2)
   04916 Melanogenesis
    111177962 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    111177962 (CREB3L2)
   04927 Cortisol synthesis and secretion
    111177962 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111177962 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111177962 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    111177962 (CREB3L2)
   04728 Dopaminergic synapse
    111177962 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    111177962 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    111177962 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111177962 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    111177962 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111177962 (CREB3L2)
   05020 Prion disease
    111177962 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    111177962 (CREB3L2)
   05031 Amphetamine addiction
    111177962 (CREB3L2)
   05034 Alcoholism
    111177962 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111177962 (CREB3L2)
   04934 Cushing syndrome
    111177962 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177962 (CREB3L2)
   05161 Hepatitis B
    111177962 (CREB3L2)
   05163 Human cytomegalovirus infection
    111177962 (CREB3L2)
   05165 Human papillomavirus infection
    111177962 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111177962 (CREB3L2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111177962 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Spc29 ZapB HAUS6_N Fmp27_WPPW TPR_MLP1_2 FlaC_arch Jnk-SapK_ap_N ADIP JMY HAUS-augmin3 OmpH RNase_Y_N TolA_bind_tri
Other DBs
NCBI-GeneID: 111177962
NCBI-ProteinID: XP_022435922
UniProt: A0A2Y9NXU2
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFAHVTASDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEEPPLEMNAGVDSSCQTVIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RAPSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENSELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGTFFQGYGPYPSATKMALPSQHSMQEPYT
ASIVRSRNLLIYEEHSPLEEPSSSASAGELGRWDRGSSLLRASGLESRPDVDLPRFIISN
ETSLEKSVLLELQQHLVSTKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggagaaaccgaggctctcatgtatcacacgcacttctcggagctgctg
gatgagttttcccagaacgtcttgggccagctcctgaacgaccctttcctctcagagaag
agtgtgtcgatggaggtagagccgtccccaacgtccccggcacctctcattcaggctgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccgttcgcccacgtcaccgcc
agtgacagcttcaatgatgatgaagtggagagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccaatcacggacgagccgccctcaggactagttccg
tctgtcactctgaccatcactgccatctctaccccttttgaaaaggaggaaccccctctg
gaaatgaacgctggggttgattcctcgtgccagacagttattcctaagattaagctggag
cctcatgaagtggatcagttcctaaacttctctcctaaggaagcctccgtggaccacctg
cacttaccgcccacccctcccagcagccacagcagcgactcagagggcagcctgagcccc
agcccgcgcctgcacccctttggcctgccgcagacccacagccccgccagggccccagcg
cgggccccctcggcacttgccagctccccactcctcaccgcaccgcacaagctgcaggga
tcaggccccctggtcctgacggaggaagagaagagaaccctgatcgccgagggctatccc
atccccacaaagttgcccctgacaaaatcagaggagaaggccctgaagaaaatccggagg
aaaatcaagaacaagatttctgcccaggaaagtaggaggaagaagaaggaatacatggac
agtttggagaaaaaggtggagtcttgttcaacggagaactccgagctccggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcagctgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggctggcacgcagactggcacctgcctc
atggttgttgtgttatgctttgccgttgcattcggcaccttctttcagggctatgggccc
tatccttctgccaccaagatggccctgcccagccagcattccatgcaggagccctacaca
gcctccattgtgagatccaggaacctgctgatctatgaggaacattctcccctggaggag
ccgtccagctccgcctcggctggggagcttgggcgctgggacagaggttcctccctgctc
agggcatcagggctggagtccaggcctgacgtggatcttccccgtttcattatatcaaat
gagaccagcctggagaaatcagtgctgttggagctgcagcagcacttggtcagcaccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacgccaccttt
taa

KEGG   Delphinapterus leucas (beluga whale): 111180225
Entry
111180225         CDS       T05885                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111180225 (CREB5)
   04024 cAMP signaling pathway
    111180225 (CREB5)
   04022 cGMP-PKG signaling pathway
    111180225 (CREB5)
   04151 PI3K-Akt signaling pathway
    111180225 (CREB5)
   04152 AMPK signaling pathway
    111180225 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111180225 (CREB5)
   04922 Glucagon signaling pathway
    111180225 (CREB5)
   04915 Estrogen signaling pathway
    111180225 (CREB5)
   04926 Relaxin signaling pathway
    111180225 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    111180225 (CREB5)
   04918 Thyroid hormone synthesis
    111180225 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    111180225 (CREB5)
   04925 Aldosterone synthesis and secretion
    111180225 (CREB5)
   04927 Cortisol synthesis and secretion
    111180225 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111180225 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111180225 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    111180225 (CREB5)
   04728 Dopaminergic synapse
    111180225 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    111180225 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    111180225 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111180225 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    111180225 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111180225 (CREB5)
   05020 Prion disease
    111180225 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    111180225 (CREB5)
   05031 Amphetamine addiction
    111180225 (CREB5)
   05034 Alcoholism
    111180225 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111180225 (CREB5)
   04934 Cushing syndrome
    111180225 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111180225 (CREB5)
   05161 Hepatitis B
    111180225 (CREB5)
   05163 Human cytomegalovirus infection
    111180225 (CREB5)
   05165 Human papillomavirus infection
    111180225 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111180225 (CREB5)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111180225 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf TolA_bind_tri ZapB Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 111180225
NCBI-ProteinID: XP_022440089
UniProt: A0A2Y9P9W1
LinkDB
Position
Unknown
AA seq 502 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFNELDCSLEHEFRKAQEEESSKRSISMHNTVGGAMVGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQQVSPATQQMQATQTIQPPQPTGGRR
RRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKN
EVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPTCSQQQVIQHNTITTSSAVS
EVVGSSTLSQLTTHRTDLNPIL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggaccatctgatgattcataggcacaagcatgaaatgactttgaagtttccc
tcaataaaaacagacaatatgttatcagatcagactccaaccccaacgagattcctgaag
aactgcgaggaggtggggctcttcaatgagctggactgctccctcgagcatgagttcagg
aaggctcaagaggaagagagcagcaagcggagtatctcgatgcataacaccgttggtggg
gccatggtggggcctggagctcaccagcttggcagcacccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacacaggca
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctccatctt
cacaacagacagagacagcccatgccagcctccatgccagggaccctgcccaaccctaca
atgccgggctcttctgccgtcttgatgccaatggagagacaaatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagcca
atgcattcggaagccaaaatgaggttgaaggctgcgttgactcaccaccctgctgccatg
tcaaatgggaatatgaacaccatgggacacatgatggaaatgatggggtcccgtcaggac
cagacgccacaccatcacatgcactcacacccacatcagcaccagacactgccagcccat
cacccctacccgcaccagcaccagcacccagcacaccatcctcaccctcagccccatcac
cagcagaaccacccacatcatcactcccactcccaccttcacgcacacccggcacatcac
cagacctcgccacacccacccctgcactccggcaaccaagcacagcaggtttcaccagcg
acacaacagatgcaggccacccagacaatacagccgcctcagcccacaggggggcgccgg
cgaagggtggtggatgaggatcctgacgagaggcggcggaaatttctggaacggaaccgg
gcagccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaa
gcagaagaactcacccagacaaacatgcaacttcagaatgaagtgtccatgttgaaaaac
gaggtggcacagctgaaacagctgttgttaacacataaagactgccccataacagccatg
cagaaagaatcacaaggatatctaagtccagagagtagccctcctgcaagccccgtcccc
acgtgctctcagcagcaggtcatccagcataacaccatcaccacttcctcggccgtcagc
gaagtggtaggaagctccaccctcagtcagctcaccactcacagaacagacctgaatccg
attctctaa

KEGG   Delphinapterus leucas (beluga whale): 111183987
Entry
111183987         CDS       T05885                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111183987 (CREB3L1)
   04024 cAMP signaling pathway
    111183987 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    111183987 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    111183987 (CREB3L1)
   04152 AMPK signaling pathway
    111183987 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111183987 (CREB3L1)
   04922 Glucagon signaling pathway
    111183987 (CREB3L1)
   04915 Estrogen signaling pathway
    111183987 (CREB3L1)
   04926 Relaxin signaling pathway
    111183987 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    111183987 (CREB3L1)
   04918 Thyroid hormone synthesis
    111183987 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    111183987 (CREB3L1)
   04916 Melanogenesis
    111183987 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    111183987 (CREB3L1)
   04927 Cortisol synthesis and secretion
    111183987 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111183987 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111183987 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    111183987 (CREB3L1)
   04728 Dopaminergic synapse
    111183987 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    111183987 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    111183987 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111183987 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    111183987 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111183987 (CREB3L1)
   05020 Prion disease
    111183987 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    111183987 (CREB3L1)
   05031 Amphetamine addiction
    111183987 (CREB3L1)
   05034 Alcoholism
    111183987 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111183987 (CREB3L1)
   04934 Cushing syndrome
    111183987 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111183987 (CREB3L1)
   05161 Hepatitis B
    111183987 (CREB3L1)
   05163 Human cytomegalovirus infection
    111183987 (CREB3L1)
   05165 Human papillomavirus infection
    111183987 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111183987 (CREB3L1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111183987 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 111183987
NCBI-ProteinID: XP_022447845
UniProt: A0A2Y9PQ81
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPIVPIKMEDTTQDMEHGAWVLG
HKLCSVMVKQEQSPELPMDPLAASSAMAAAAAMATTPLLGLSPLTRLPIPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMASDSVYTASQM
PSRSLLFYDEGPGSWEDGRSALLPVEPPDGWEIKPGGPAEQQPQDHLQHDHLDSTHETSK
YLSEAWPKDVGGNSTSSDFSHPKEWFHERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtctgatttcctcaacaatgcgcacttccctgagcacctg
gaccactttgcagagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccccgtgctggacgagaagagccctctactggacatggaactggactcccccacaccg
ggcatccaggccgagcacagctactccctgagcggtgactcggcacctcagagccccatt
gtgcccatcaagatggaggataccacccaagatatggaacacggagcgtgggtgctggga
cacaaactgtgctcggtcatggtgaagcaggagcagagcccggagctgcccatggaccct
ctggctgcctcctcagccatggctgccgctgccgccatggccaccaccccgctgctgggc
ctcagccccctgaccaggctgcccatcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaagcagagcctcaggaggtaaaccagttcctcaaagtgacaccagaggac
ctggtgcagatgcctccgacgccccccagcagccatggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccccatccggcccatggcccgctcctccacagcc
atctccacctccccactcctcactgcccctcacaaattacaggggacgtcggggccactg
ctcctgacggaggaggaaaagcgcaccctgattgctgagggctaccccatccccacgaag
ctccccctcaccaaagctgaggagaaggccttaaagagggtccggaggaaaatcaagaac
aagatctcggcccaggagagccgccgtaagaagaaggagtacgtggagtgtctagaaaag
aaggtggagacctttacatccgagaacaacgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggctgccacccagactgggacctgcctcatggtggcagcc
ttgtgcttcgtcctggtgctgggctccctcgtgccctgcctccctgagttctcctccggc
tcccagactgtgaaggaagatcccatggcctctgacagcgtctacactgccagtcagatg
ccctcccgaagcctcctgttctatgatgaggggccaggctcatgggaggatggccgcagc
gccctgctgcccgtggagcccccagatggctgggagatcaagcccggggggccggcggag
cagcaaccccaggaccacctgcagcatgaccacctggacagcacccacgagaccagcaag
tacctgagtgaggcctggcccaaggacgtcggtggaaacagcaccagttctgacttctcc
caccctaaggagtggttccacgagagggatctgggccccaacaccaccatcaaactctcc
tag

KEGG   Delphinapterus leucas (beluga whale): 111186212
Entry
111186212         CDS       T05885                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4 isoform X1
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04137  Mitophagy - animal
dle04141  Protein processing in endoplasmic reticulum
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04932  Non-alcoholic fatty liver disease
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111186212 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111186212 (ATF4)
   04668 TNF signaling pathway
    111186212 (ATF4)
   04022 cGMP-PKG signaling pathway
    111186212 (ATF4)
   04151 PI3K-Akt signaling pathway
    111186212 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111186212 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    111186212 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111186212 (ATF4)
   04922 Glucagon signaling pathway
    111186212 (ATF4)
   04912 GnRH signaling pathway
    111186212 (ATF4)
   04915 Estrogen signaling pathway
    111186212 (ATF4)
   04926 Relaxin signaling pathway
    111186212 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    111186212 (ATF4)
   04918 Thyroid hormone synthesis
    111186212 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    111186212 (ATF4)
   04925 Aldosterone synthesis and secretion
    111186212 (ATF4)
   04927 Cortisol synthesis and secretion
    111186212 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111186212 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    111186212 (ATF4)
   04728 Dopaminergic synapse
    111186212 (ATF4)
   04720 Long-term potentiation
    111186212 (ATF4)
   04722 Neurotrophin signaling pathway
    111186212 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    111186212 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111186212 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    111186212 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111186212 (ATF4)
   05012 Parkinson disease
    111186212 (ATF4)
   05014 Amyotrophic lateral sclerosis
    111186212 (ATF4)
   05020 Prion disease
    111186212 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    111186212 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    111186212 (ATF4)
   05031 Amphetamine addiction
    111186212 (ATF4)
   05034 Alcoholism
    111186212 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111186212 (ATF4)
   04934 Cushing syndrome
    111186212 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186212 (ATF4)
   05161 Hepatitis B
    111186212 (ATF4)
   05163 Human cytomegalovirus infection
    111186212 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111186212 (ATF4)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    111186212 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450 AAA_13 Fez1 Laminin_II bZIP_Maf Nop53 ZapB
Other DBs
NCBI-GeneID: 111186212
NCBI-ProteinID: XP_022452209
UniProt: A0A2Y9PZH2
LinkDB
Position
Unknown
AA seq 350 aa
MAEKSFLSSEVLVVDFMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGFSE
WLAMDGLVSASGNGKEDAFSGTDWMVEKMDLKEFDFNALLGIDDLETMPDELLASLDDTC
DLFDPLLQEATKEPPQIVNPIGHLPESLPTTDQGAPFTFLQPLPLSPGALFSTPDHSFTL
ELCSEVMSEEDRKPDSTAYVMLVPQCVKEEDAPSDNDSGVCMSPDSYLGSPQHSPPTSRG
SPNRSLLSPGAPGGSVRPKPYDPPGEKMIAKVKGEKLDKKLKKMEQNKTAATRYRQKKRA
EQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRSP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggccgagaagagcttcctgagcagcgaggtgttggtggtggacttcatgtcccccttc
gaccagtcgggtttgggggctgaagagagcctgggtctcctagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctctggcgacaaggctaaggcgggcttctccgaa
tggctggctatggatgggttggtcagtgcctcaggtaacggcaaggaggatgctttctct
gggacagattggatggtggagaaaatggatctgaaggagttcgattttaatgctctgttg
ggtatagatgatctggaaaccatgccagatgagcttttggcctcgttggatgacacgtgt
gatctctttgaccccctactccaggaggctactaaggagcccccccagatcgtgaaccca
ataggccatcttccagaaagtttgccaacaactgaccagggtgcccctttcactttcttg
cagcctcttcccctctccccaggggccctgttctccactccagatcattcttttacttta
gagctatgcagtgaagtgatgtctgaagaagataggaagccagactctactgcttacgtt
atgctggtccctcagtgcgtaaaggaagaggatgctccctcagataatgatagtggcgtc
tgtatgagccctgactcctatctgggctctccccagcatagcccccctacctccaggggt
tctccaaatagaagcctgctatctccaggtgcccctggtggctctgtccgccccaagccc
tatgaccctcctggagagaagatgatagcaaaagtaaagggtgagaaactagataaaaaa
ctgaagaaaatggagcagaacaagacagcagccactaggtaccgccagaagaagagggca
gagcaggaggccctcactggtgaatgtaaagagctagaaaagaagaatgaggctctgaaa
gagaaggcagattccttggccaaggagatccagtatctgaaagatttaatagaagaggtc
cgcaaggcaagggggaagaagaggagcccctag

KEGG   Delphinapterus leucas (beluga whale): 111188007
Entry
111188007         CDS       T05885                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04261  Adrenergic signaling in cardiomyocytes
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04725  Cholinergic synapse
dle04728  Dopaminergic synapse
dle04911  Insulin secretion
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04922  Glucagon signaling pathway
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04931  Insulin resistance
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04962  Vasopressin-regulated water reabsorption
dle05016  Huntington disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05034  Alcoholism
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111188007 (CREB3)
   04024 cAMP signaling pathway
    111188007 (CREB3)
   04022 cGMP-PKG signaling pathway
    111188007 (CREB3)
   04151 PI3K-Akt signaling pathway
    111188007 (CREB3)
   04152 AMPK signaling pathway
    111188007 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111188007 (CREB3)
   04922 Glucagon signaling pathway
    111188007 (CREB3)
   04915 Estrogen signaling pathway
    111188007 (CREB3)
   04926 Relaxin signaling pathway
    111188007 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    111188007 (CREB3)
   04918 Thyroid hormone synthesis
    111188007 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    111188007 (CREB3)
   04916 Melanogenesis
    111188007 (CREB3)
   04925 Aldosterone synthesis and secretion
    111188007 (CREB3)
   04927 Cortisol synthesis and secretion
    111188007 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111188007 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111188007 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    111188007 (CREB3)
   04728 Dopaminergic synapse
    111188007 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    111188007 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    111188007 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111188007 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    111188007 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111188007 (CREB3)
   05020 Prion disease
    111188007 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    111188007 (CREB3)
   05031 Amphetamine addiction
    111188007 (CREB3)
   05034 Alcoholism
    111188007 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111188007 (CREB3)
   04934 Cushing syndrome
    111188007 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111188007 (CREB3)
   05161 Hepatitis B
    111188007 (CREB3)
   05163 Human cytomegalovirus infection
    111188007 (CREB3)
   05165 Human papillomavirus infection
    111188007 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111188007 (CREB3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111188007 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 111188007
NCBI-ProteinID: XP_022455889
UniProt: A0A2Y9QL41
LinkDB
Position
Unknown
AA seq 370 aa
MSHMELALDPGDHDLLGFLLEESGGLVAAPDEALEAPLGWELPLYEALSNWDVEDFLSCL
PSPPASLTVFSNSNPCLVHHDHTYSLSREHVSIDVDTERYGEEGAQMTPLHVEEPAEQEP
QEIARLILTEEEKRLLEKEGLTLPGTLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVY
VGRLESRVLKYTAQNLELQNKVQLLEEENLSLLDQLRKLQAMMIQTANKASSGTCVLVLL
FSFCLLFVPVMYSSDTRGSLPAERGVLSRQLRALPSEDPPQLEQPALQSEVPKDSLDHEL
QALSNSYCLFYHMPQAPSAEPPLKLPLPDSFSASSCPGPISPLHANLTSEGGWLPTHSST
SVILPGRYSG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtctcatatggagctggcgttggacccgggtgaccatgacctgctgggcttcttgcta
gaggaaagcggaggtttggtggcggcgcccgatgaggccttggaggctccgctgggttgg
gagctgccactttatgaggctctgagcaattgggacgtagaggatttcctgagctgcctg
ccgagtcccccagcatcgttgaccgttttcagcaattctaacccctgtcttgtccaccat
gatcacacctattctctctcacgggagcatgtctccatagatgtggatactgagagatat
ggagaagagggggctcagatgactccattgcatgtggaggagccggcagagcaggaaccc
caggagattgctaggctaatactgactgaggaggagaagaggctcttggagaaggagggg
cttaccctgcctgggacgcttcctcttactaagatggaggaacaagttctgaaacgagtg
cggaggaagattcgaaacaaaaagtctgctcaagagagccgcaggaagaagaaggtgtat
gtggggcgtttagagagcagggttctgaaatacacagcccagaatctggagctacagaac
aaagtacagctcctggaggaggagaatctgtcccttttggatcagttgaggaaactccag
gccatgatgattcagacagcaaacaaagccagcagcggcacctgtgtcttggtcctgctg
ttctctttctgtctccttttcgtacctgtgatgtactcgtcggacacaagggggagtctg
ccagctgagcgtggagtgttgtcccgccagcttcgtgccctccccagcgaggaccctccc
cagctggagcagcctgccctgcagtcagaggtaccaaaggacagcttggaccatgagctc
caggctcttagcaattcttactgcctcttctatcacatgcctcaagctcctagtgcagag
cctcccctgaagttgccactgcctgacagtttctcagcgtcctcctgcccaggtcccatc
tctcccctgcatgcaaatctcacaagtgagggaggatggctccctacccacagctccacg
tctgttatcttgccgggcagatattcaggctag

DBGET integrated database retrieval system