KEGG   Delphinapterus leucas (beluga whale): 111166300
Entry
111166300         CDS       T05885                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04020  Calcium signaling pathway
dle04066  HIF-1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04520  Adherens junction
dle04530  Tight junction
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05219  Bladder cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111166300 (ERBB2)
   04012 ErbB signaling pathway
    111166300 (ERBB2)
   04066 HIF-1 signaling pathway
    111166300 (ERBB2)
   04020 Calcium signaling pathway
    111166300 (ERBB2)
   04151 PI3K-Akt signaling pathway
    111166300 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111166300 (ERBB2)
   04520 Adherens junction
    111166300 (ERBB2)
   04530 Tight junction
    111166300 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166300 (ERBB2)
   05206 MicroRNAs in cancer
    111166300 (ERBB2)
   05205 Proteoglycans in cancer
    111166300 (ERBB2)
   05230 Central carbon metabolism in cancer
    111166300 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111166300 (ERBB2)
   05226 Gastric cancer
    111166300 (ERBB2)
   05219 Bladder cancer
    111166300 (ERBB2)
   05215 Prostate cancer
    111166300 (ERBB2)
   05213 Endometrial cancer
    111166300 (ERBB2)
   05224 Breast cancer
    111166300 (ERBB2)
   05223 Non-small cell lung cancer
    111166300 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111166300 (ERBB2)
   01524 Platinum drug resistance
    111166300 (ERBB2)
   01522 Endocrine resistance
    111166300 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166300 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111166300 (ERBB2)
   04090 CD molecules [BR:dle04090]
    111166300 (ERBB2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111166300 (ERBB2)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111166300 (ERBB2)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   111166300 (ERBB2)
CD molecules [BR:dle04090]
 Proteins
  111166300 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 111166300
NCBI-ProteinID: XP_022413562
UniProt: A0A2Y9M2S5
LinkDB
Position
Unknown
AA seq 1255 aa
MELAAWCRWGLLLALLPPGDAGTQVCTGTDMKLRLPASPNTHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQEIQEVQGYVLIAHNQVSQVPLQRLRIVRGTQLFEDNYALAVLDNG
GLLESATPAARAAPGGLQELQLRSLTEILKGGVSIQRNPQLCHQDTIVWKDIFHRNNQLA
LMLIDTNRSRACPPCSPACKAPHCWGESSKDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTTCP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDRASNTAPLQPEQLRVFESLEEITGYLYISAWPDSLP
DLHVFQNLRVIRGRVLHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEVECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQQC
VEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACTHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGMCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLVVVVGLVFGILVKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPTSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGSGGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDSSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPRPPPRPAGSTLERPKTLSPGKNGVVKDIFAFGAAVENPEYLAPR
GRAAPQSHSSPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDMPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagac
gcgggcacccaagtgtgcactggcacagacatgaagctgcggctgccggccagtcccaac
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggtaacctg
gagctcacctacctgcccgctaatgctagcctctccttcctgcaggagatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgagtcaggtccccctgcagaggctgcgg
atcgtgcgaggcacccagctgtttgaggacaactatgccctggccgtgctggacaacgga
ggccttctggaaagtgccacccctgctgcacgcgctgctccgggagggctgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggggtctcgatccagcggaacccccag
ctctgccaccaggacacgattgtgtggaaggacatcttccacaggaacaaccagctggcc
ctcatgctgatagacaccaaccgctcacgggcctgcccaccctgttctccagcttgtaaa
gctccccactgctggggagaaagttccaaggactgtcagagcttgacgcgaaccgtctgt
gccagcggctgtgcccgctgtaagggcccgcagcccaccgactgctgccacgagcagtgt
gctgctggctgcacgggccccaagcactctgactgtctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttataccttcggcgccagctgcgtgaccacctgtcct
tacaactacctgtccacggacgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgagggggaccgagcctccaacactgcccccctacagcctgagcagctcagagtattt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgccg
gacctccacgtcttccagaatctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatccgctggctggggctgcgctcgctgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggtcgagtgcgtgggcgagggcctggcctgctacccgctgtgtgcccacgggcactgc
tggggtccagggcccacccagtgcgtcaactgcagccagttccttcggggccagcagtgc
gtggaagaatgccgagtactgcaggggctcccccgggagtacgtgaaggacaggtactgt
cttccgtgccaccccgagtgtcagccccagaatggctcagtgacctgctttggctcggag
gctgaccagtgtgtggcttgcacccactacaaggatcctcccttctgcgtggctcgctgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcatgtgccagccatgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgctgagcagagagccagccctgtgacgtccatcattgccgctgtggtgggc
attctgctggtcgtcgtcgtggggctggtcttcggcatcctcgtcaagcggcggcggcag
aagatccggaagtacacgatgcggaggctgctgcaggagacagagctggtggagcccctg
acaccgagcggagccatgccaaatcaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggtaccgtctacaagggcatctggatc
cccgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggccggtgtagggtcccca
tatgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgggagcaccgcgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggaggatgtgcgg
ctcgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
attacagactttgggctggctcggctgctggacattgatgagacagagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctcctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccaaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaagacttgggccctaccagccccttg
gacagcaccttctaccgctcactgctggaggatgatgacatgggggacctggtggatgct
gaggagtacctggtaccccagcaaggcttcttctgcccagaccctgccccgggctctggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctgggtctggagccctcggaggaggagccccccaggtctccactggcaccttccgaaggg
gctggctctgatgtgtttgacggcgacttgggaatgggggcagccaaggggctgcagaac
ctcccccaacatgactccagccctctacagcggtacagcgaggaccccacagtaccgctt
cctcccgagaccgatggctacgttgcccccctgacctgcagcccccagcccgaatacgtg
aaccagccagaggttcggccacagcccccctcacccctagagggtcctcggcctcctcct
cgacctgccggttccactctggaaaggcccaagactctctcccctgggaagaatggggtt
gtcaaagacatttttgcctttggggctgccgtggagaaccccgagtacttggcaccccgg
ggcagggctgcccctcagtcccactcttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggatctccacccagcacctttgaagggacc
cctacggcagagaaccctgagtacctgggtctggacatgccagtatga

DBGET integrated database retrieval system