KEGG   Delphinapterus leucas (beluga whale): 111166337
Entry
111166337         CDS       T05885                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04217  Necroptosis
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04917  Prolactin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111166337
   04630 JAK-STAT signaling pathway
    111166337
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166337
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166337
   04659 Th17 cell differentiation
    111166337
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111166337
   04935 Growth hormone synthesis, secretion and action
    111166337
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166337
   05203 Viral carcinogenesis
    111166337
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111166337
   05220 Chronic myeloid leukemia
    111166337
   05223 Non-small cell lung cancer
    111166337
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111166337
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166337
   05161 Hepatitis B
    111166337
   05162 Measles
    111166337
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111166337
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111166337
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 111166337
NCBI-ProteinID: XP_022413645
UniProt: A0A2Y9LW47
LinkDB
Position
Unknown
AA seq 818 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRPQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDHCPMELVRCIRHILYNEQRLV
REANSGSSSSGILVDAMSQKHLQINQTLEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMSPPQVKATIISEQQAKSLLKNENTRNEYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GSSHLEDYNGMSVSWSQFNRDMTRGCGSLLECGASRMRNWEKVWENLPGWNYTFWQWFDG
VMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSP
DRNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVK
PQIKQVVPEFVSASADSAGSSATYMDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDE
TMDVARHVEELLRRPMDSLDPRLSPPTGLFTSARGSLS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccaacagctgcagggagatgcacttcgccagatgcaggtg
ctgtatgggcagcacttccccatcgaggtccggcattacttagcacagtggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgaccccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggctgagcaccaagtaggggaagatggg
ttcttactgaagatcaagctggggcattatgccacgcagctccagaacacgtatgaccac
tgccccatggaattggtgcgctgcatccgccatattctgtacaatgaacagaggctggtc
cgagaagccaacagtggtagttcttcttctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacacttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaagagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacaatcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacgttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgagccccccccaggtgaaggcgaccatcatcagcgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaatgagtacagcggagagatcttgaacaactgc
tgtgtgatggagtatcaccaggccacgggcaccctcagcgctcacttcaggaacatgtcg
ctaaagaggattaagcgcgctgaccggcgaggcgcagagtccgtgacagaggagaagttc
acggtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgtttcaggtgaag
accctgtcccttcctgtggttgtcattgttcatggcagccaggaccacaatgctactgcc
accgtgctatgggacaatgcctttgctgagccgggcagggtgccgtttgcagtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctcttcaacagc
ggtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gatatgaccaggggctgtggcagtttgctggagtgtggggcaagtcggatgaggaactgg
gagaaggtctgggagaacttgccaggctggaactacaccttctggcagtggttcgatggg
gtcatggaggtgctgaagaaacatcacaagccccattggaatgacggggccatcctaggt
tttgtgaataagcaacaggcccatgacctgctcatcaacaagcccgacggcaccttcttg
ttgcgctttagcgactcagaaatagggggcatcaccattgcctggaagtttgactctcct
gaccgtaacctgtggaatctgaagccgttcaccacgcgggatttctccatccggtccctg
gccgaccggctgggggacctgagctatctcatctacgtgtttcccgaccggcccaaggat
gaggtcttctccaagtactatactcccgtgctcgctaaagcagtggacggatacgtgaag
ccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcggactctgccgggagc
agcgccacctacatggaccaggccccctccccagccgtgtgcccccaggctcattataac
atgtacccacagaaccctgaccccgtcctcgaccaggatggagaatttgacctggatgag
accatggatgtggctcggcacgtggaggaactcttacgacgccctatggacagtctggac
ccccgcctctccccacctactggtctcttcacctctgccagaggctcgctctcgtga

KEGG   Delphinapterus leucas (beluga whale): 111166483
Entry
111166483         CDS       T05885                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04062  Chemokine signaling pathway
dle04217  Necroptosis
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04917  Prolactin signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111166483
   04630 JAK-STAT signaling pathway
    111166483
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166483
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166483
   04659 Th17 cell differentiation
    111166483
   04062 Chemokine signaling pathway
    111166483
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111166483
   04935 Growth hormone synthesis, secretion and action
    111166483
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166483
   05203 Viral carcinogenesis
    111166483
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111166483
   05220 Chronic myeloid leukemia
    111166483
   05223 Non-small cell lung cancer
    111166483
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111166483
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166483
   05161 Hepatitis B
    111166483
   05162 Measles
    111166483
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111166483
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111166483
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 111166483
NCBI-ProteinID: XP_022413924
UniProt: A0A2Y9LW55
LinkDB
Position
Unknown
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGNSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVQATIISEQQAKSLLKNENTRNEYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
SSATYMDQAPSPAVCPQAHYNMYPQNPDPVIDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagca
ttgtatggtcagcatttccccattgaggtgcggcattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctt
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactacgccacacagctccagaatacatatgatcgc
tgccccatggagctggtccgctgcatccgccatattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtaattctccggctggaagtctcgctgatgccatgtcccagaaa
caccttcagataaaccagacatttgaggagctgcgactggtcacgcaagacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaagagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacaatcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacgttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgcaggcgaccatcatcagcgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaatgagtacagcggagagatcttgaacaactgc
tgtgtgatggagtatcaccaggccacgggcaccctcagcgctcactttaggaacatgtcc
ctgaaacgaattaagaggtctgaccgtcgtggagcggagtcggtgacggaagaaaaattt
acaatcctgtttgaatcacagttcagtgttggtggaaatgagctggtttttcaggtcaag
accctgtccctcccggtggtggtgattgttcacggcagccaggacaacaatgcgacggcc
actgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcagtgcctgac
aaagtcctgtggccacagctgtgcgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctcttcaacagc
ggtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcagtggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggctatcttgggtttcgtgaacaag
caacaggcccacgacctactcattaacaagcctgacgggaccttcctgctgaggttcagt
gactctgaaattggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccatccggtccctggctgaccgcttg
ggagacctgagttaccttatctacgtgtttcctgaccggccaaaagatgaagtgtactcc
aaatattacaccccagttccctgcgagcctgccactgctaaagcagtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcggactctgccggg
agcagcgccacctacatggaccaggccccctccccagccgtgtgcccccaggctcattat
aacatgtacccacagaaccctgaccccgtcattgacaatgatggggactttgatctggac
gacacgatggacgtggcacggcgcgtggaggagctcttaggccgacctatggacagtcag
tggatcccccacgcacagtcgtga

KEGG   Delphinapterus leucas (beluga whale): 111166491
Entry
111166491         CDS       T05885                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04217  Necroptosis
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04659  Th17 cell differentiation
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04931  Insulin resistance
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05145  Toxoplasmosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05212  Pancreatic cancer
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166491 (STAT3)
   04066 HIF-1 signaling pathway
    111166491 (STAT3)
   04068 FoxO signaling pathway
    111166491 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166491 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111166491 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111166491 (STAT3)
   04062 Chemokine signaling pathway
    111166491 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111166491 (STAT3)
   04917 Prolactin signaling pathway
    111166491 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    111166491 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166491 (STAT3)
   05206 MicroRNAs in cancer
    111166491 (STAT3)
   05205 Proteoglycans in cancer
    111166491 (STAT3)
   05203 Viral carcinogenesis
    111166491 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111166491 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111166491 (STAT3)
   05221 Acute myeloid leukemia
    111166491 (STAT3)
   05223 Non-small cell lung cancer
    111166491 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    111166491 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111166491 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111166491 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111166491 (STAT3)
   05160 Hepatitis C
    111166491 (STAT3)
   05171 Coronavirus disease - COVID-19
    111166491 (STAT3)
   05162 Measles
    111166491 (STAT3)
   05163 Human cytomegalovirus infection
    111166491 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166491 (STAT3)
   05169 Epstein-Barr virus infection
    111166491 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111166491 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111166491 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111166491 (STAT3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111166491 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Baculo_PEP_C Fib_alpha
Other DBs
NCBI-GeneID: 111166491
NCBI-ProteinID: XP_022413945
UniProt: A0A2Y9LX05
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNSQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctggacacacggtacttggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctacggcagtttctagccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcaactttggtgtttcataatctc
ttgggtgaaattgaccagcagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaacctgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccatcccacagccgccgtggtgacggagaag
cagcaaatgctggagcaacacctgcaggatgtccggaagcgtgtccaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagacatgcaagacctgaatggaaacagccagtcagtgaccaggcagaagatg
cagcagctcgagcaaatgcttaccgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcagggcttttgtcagctatggagtacgtacagaaaactctcacggatgaagagctg
gcggactggaagaggcggcagcagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattggcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcagaaagtgagctacaaaggggatcccattgtacag
caccggccaatgctggaggagagaatcgtagagctgtttagaaacttaatgaaaagtgcc
ttcgtggtagagcggcagccctgcatgcctatgcatcccgaccggccattagtcatcaag
accggtgtccagtttacaactaaagtcagattgctggtcaaatttcctgagctaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagagga
tcccggaaatttaacatcctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aacggcagcctctccgcagagttcaaacacttgaccctgagagagcagagatgtggtaac
gggggccgagccaactgcgacgcctccctgattgtgactgaagagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctagagacccactccttgcca
gttgtggtgatctccaacatctgtcagatgcccaacgcctgggcatccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccaccaagcgcgggctg
agcatcgagcagttgacaacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacgtgggctaaattttgcaaagaaaacatggccggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggctttatcagtaaggagagggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccatac
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgccaccaacatcctcgtgtctccgctggtctatctctaccctgacattccaaaggag
gaggcgttcggaaagtactgccggccagagagccaggagcatcccgaagctgacccaggt
agtgctgccccatacctgaagactaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcaatttgaatccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system