KEGG   Delphinapterus leucas (beluga whale): 111166388
Entry
111166388         CDS       T05885                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04640  Hematopoietic cell lineage
dle04810  Regulation of actin cytoskeleton
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111166388 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111166388 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111166388 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111166388 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111166388 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166388 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111166388 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111166388 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111166388 (ITGA3)
   05414 Dilated cardiomyopathy
    111166388 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111166388 (ITGA3)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111166388 (ITGA3)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111166388 (ITGA3)
CD molecules [BR:dle04090]
 Proteins
  111166388 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 111166388
NCBI-ProteinID: XP_022413747
UniProt: A0A2Y9M3C9
LinkDB
Position
Unknown
AA seq 1068 aa
MGPGPSRAARVLRPMFCALALMVAASDRVASAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVPDGYTNQTGAVYLCPLTAHKNDCERMDIAEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTY
HNEMCNSNTDYLETGMCQLGASGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
DPADQGNLYIGYTMQVGSAVLHPTSTTIVTGAPRHQHVGAVFLLSQEAGGDLRRRQVLEG
RQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSRSAFGFSVASIGDINQDGFQDVAVGAPFEGLGKVYLYHGSSRGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPSVL
DPALCTATSCVQVELCFAYNQSAGDPNYRRNITLAYTLEADRDRRPPRLRFARSQSAIFH
GFFSMPEMRCQTLELLLMDNVRDKLRPIIISMNYSLPLRMPERPRLGLRSLDAYPVLNQA
QALENHTEVQFQKECGPDNKCDSNLQMQAAFVSELGQRLSRLPYSRDFRKLLLSINLTNT
PSRERAGEDAHEALLTLAVPPALLLSSVRPPGACQANETMTIVCELGNPFKRNQRMELLI
AFEVIGVTLHTRELQAQLQLSTSSHQDDLWPITLTLLVDYTLQASLSMVSHRLQSFFGGT
VMGESGMKTVEDVGSPLKYEFQVGPVGEGLAALGTLILGLEWPYEVSNGKWLLYPTEITV
HGNGSWHCRPPGDLVNPLNLTLSVPGDRPPSPQRRRRQLDPGGGQGPLPVTLAAAKKAKS
EIQLSCGGDHTRCVWLECRIPDAPVITNVTVQARVWNSTFIEDYKDFDRVRVASWATLFL
RTSVPTINMENKTVRFSVDIDSELVEELPAEIELWLVLVAVSAGLLLLGLIILLLWKCDF
FKRTRYYRIMPKYHGVRIREEERYPPPGRTLPTKKHWVTSWQTRDRYY
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgccgcccgcgtcctacgcccgatgttctgcgcgctcgcc
ttgatggtggccgccagcgaccgcgtcgcctccgccttcaacctggacacccgattcctg
gtggtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacggagcggcagcagcgttacctgctcctggctggcgccccccgggaccttgctgtg
cctgatggctataccaaccagaccggtgcagtgtacctgtgcccactcaccgcccacaag
aacgactgtgaacggatggacattgcagagaaaagtgaccctgaccatcacattattgag
gacatgtggctcggggtgactgtggccagccagggccctgcgggcagagtcctggtctgt
gcccaccgctacacccaggtgttgtggtcggggtcggaggaccagcggcgcatggtgggc
aagtgctatgtgaggggcaacgacctggagctggaccccagtgatgactggcagacctac
cacaacgagatgtgcaacagcaacaccgactacctggagaccggcatgtgtcagctgggc
gccagcggcggcttcacccaaaacactgtgtactttggcgctcctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatccgaatatagttacaag
gacccagcggaccaaggcaacctctacattggctacacgatgcaggtgggcagtgccgtc
ctgcaccctacgagcaccaccattgtgacgggtgcccctcggcaccaacacgtgggcgct
gtctttttgctgagccaggaggcgggtggagacctgcggaggaggcaggtgctggagggc
aggcaggtgggcgcctattttggcagtgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgccccctattactttgagcggaaagaggaggtagggggt
gccatttatgtcttcatgaaccaggcaggcacctccttcccggcccacccctccctcctt
cttcacggccccagtcgctctgcctttggcttctccgtggcaagcatcggtgacatcaac
caggatggattccaggacgttgccgtgggagcccctttcgagggcttgggcaaagtgtac
ctctaccacggcagctccagggggctcctcagacagccccagcaggtaatacacggagag
aagctgggactgcctggcttggccaccttcggctactccctgagtgggcagatggatgtg
gatgagaacctctacccagacctgctggtggggagcctgtcagaccacatcgtgctgctg
cgggcccggcctgtcatcaacatcctccacaggaccttggtggccaggccatctgtactg
gaccccgcactctgcacagccacctcctgcgtgcaggtggagctgtgctttgcttacaac
cagagtgccggggaccccaactacaggcggaacatcaccctggcctacactctggaggcc
gaccgggaccgccgcccaccccggctccgctttgcacgcagtcagtcagctatcttccat
ggcttcttctccatgcccgagatgcgctgccagacgctggagctgctcctgatggacaac
gtccgcgacaaactccgacccatcatcatctccatgaactactctttacctttgcggatg
cctgagcgcccccgactggggcttcggtccctggacgcctacccggtcctcaaccaggcg
caggctctggagaaccacacggaggtccagttccagaaggagtgcgggccggacaacaag
tgcgacagcaacttgcagatgcaggcggccttcgtgtctgagctggggcagcggctgagc
aggctcccgtacagtagagacttccgaaaactgctgctgagcatcaacttgaccaacacc
ccaagccgggagcgggctggggaagacgcccacgaggcgctgctcaccctggcggtgcct
cccgccctgctgctgtcctcagtgcgcccccctggagcttgccaagccaacgagaccatg
accatcgtttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatt
gccttcgaggtcattggggtgaccctgcacacaagggaactccaggcacagctgcagctc
tccacgtcaagtcaccaggatgacctgtggcccataaccctgactctgctggtggattac
acactccaggcctcgctcagcatggtgagtcaccggctacaaagcttctttggggggaca
gtgatgggtgagtctggcatgaaaactgtggaggatgtgggaagccctctcaagtatgaa
ttccaggtgggcccagtgggggaagggctggcagcccttggtaccctgatcctggggctg
gagtggccctatgaagtcagcaatggcaagtggctgctataccccacagagatcacggtc
cacggcaatgggtcctggcactgccggccacctggagaccttgtcaaccctctcaacctc
actctctctgttcctggggacaggccgccatctccacaacgcaggcggcgacaactggac
cccgggggaggccagggccccctgccggtcactctggctgctgccaagaaagccaagtct
gagatccagctgagctgtggcggtgaccacacccgctgtgtgtggctggagtgcaggatt
cctgatgcccccgtcatcaccaacgtgacagtgcaggcacgagtgtggaacagcaccttc
atcgaggattacaaagactttgaccgagtcagggtagccagctgggccaccctgttcctc
cgaaccagcgtccccaccatcaacatggagaacaagacggtgcggttctccgtggacatt
gactctgagctggtggaggagctgccggccgagatcgagctgtggctggtgcttgtggct
gtgagtgccgggctgctgctgctggggttgatcatcctcttgctgtggaagtgtgacttc
tttaagcggacccgctattaccggatcatgcccaagtaccacggggtgcggatccgggag
gaggagcgctacccacctccagggagaaccctgcccaccaagaagcactgggtgaccagc
tggcagactcgcgaccgatactactga

KEGG   Delphinapterus leucas (beluga whale): 111170236
Entry
111170236         CDS       T05885                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04015  Rap1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04611  Platelet activation
dle04640  Hematopoietic cell lineage
dle04810  Regulation of actin cytoskeleton
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111170236 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    111170236 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111170236 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111170236 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111170236 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111170236 (ITGA2B)
   04611 Platelet activation
    111170236 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170236 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111170236 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111170236 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    111170236 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111170236 (ITGA2B)
   05414 Dilated cardiomyopathy
    111170236 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111170236 (ITGA2B)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111170236 (ITGA2B)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111170236 (ITGA2B)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111170236 (ITGA2B)
CD molecules [BR:dle04090]
 Proteins
  111170236 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 111170236
NCBI-ProteinID: XP_022420915
UniProt: A0A2Y9MG98
LinkDB
Position
Unknown
AA seq 1034 aa
MARALCPLHALWLLEWVQLLLGPGAAPPTWALNLDPVRLTFYTGPNGSYFGFSLDFYKDS
RGSVSIVVGAPRTLGRSQEETGGVFLCPWKAEGDQCTSLPFDLNDETRSAGTQTFQTFKA
RQGLGASVVSWSDIVVACAPWQHWNVLEKAEEAEKTPVGGCFVAQLQNSGRAEYSPCRAN
IMSRVYQKNYFGGDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLARAPIADIISSYRP
GTLLWHVPTQQLTFDYSHPEYFDGYRGYSVAVGDFDGNPNTTEFVFGAPTWSWTLGAVEI
LSSNHQTLHRLHGEQMASYFGHSVAVTDVNRDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQTRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLNSHPSQVLDSPFPTGSGFGFSLRGATDIDDNGYPDLLVGAYGANKVVVYR
AQPVVMATVQLLVQDSLNPAVKNCVLPLTETPVSCFNIQMCVGATGHNVPKKLHLNAELQ
LDRQKPRQGRRVLLLASQQASTILGLDLSGRHGPTCHTTKAFLRDEADFRDKLSPIVLSL
NVSLQPEKDGLAPALMLHGDTHIQEQTRIILDCGEDDLCVPQLQLTASVTGSPLLIGADN
MLQLQMEAANDGEGAYEAELAVHLPPGAHYMRALSNTEGFERIICNQKRENETKVVLCEL
GNPMKRNAQIGITMLVSVGNLEEAGEHVSFRLQIRSKNSQNPNSEMVMLDVPVRAEAHVE
LRGNSFPASLVVAAEESKRENSSDSWGPKVEHTYELHNNGPGAVKGLRLNLRLPGQSQPS
DLLYILDIQPRGGLQCSPQPSPNPLKLDWGLPTSSPSQAYHKRDRRQALLPEQEQPSRLQ
GPVFVSCDSAPCTVVQCELQEMARGQRVMVTVLAFLSLPSLRQRPLDQFVLQSHAWFNVS
SLPYAVPALSLPSGEALVQTQLLRVLEERDIPIWWVLLGVLGGLLLLTFLVLAMWKVGFF
KRNRPPLQEDDEEE
NT seq 3105 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccacttcatgccctctggcttctggagtgggtgcagctgctc
ttgggacccggtgctgcacctccaacctgggccttgaacctggacccggtgcgactcacc
ttctacacaggccccaatggtagctactttgggttttcattggacttctacaaggacagc
cgtgggagcgtgtccatcgtggtgggcgccccacggaccctgggccgcagccaggaggag
acaggcggcgttttcctgtgcccctggaaggccgagggcgaccagtgtacctcgctgccc
ttcgacctcaatgatgagacgcgaagcgcaggcacccaaactttccaaaccttcaaggcc
cgtcaaggactaggggcgtcggtcgttagttggagcgacatcgttgtggcctgcgccccc
tggcagcactggaacgtcctggaaaaggccgaggaggctgagaagacgcccgtaggtgga
tgcttcgtggctcagctgcagaacagcggccgcgcagagtactcaccctgccgggccaac
atcatgagccgggtttaccagaaaaattacttcggcggagacaagcgctactgtgaagcc
ggcttcagctccgtggtcactcaggctggggagctggtgcttggggcccctggcggctac
tatttcctaggtctcctggcgcgggctccaattgccgatatcatctcgagttaccgcccg
ggcaccctcttgtggcacgtgcccacccagcagctcaccttcgactacagccacccagag
tacttcgacggctaccgggggtactcggtggctgtaggcgacttcgacgggaatccaaac
actacagagtttgtcttcggtgcccctacctggagctggaccctgggagcggtggaaatt
ttgagctcgaaccaccagacgctgcaccggctgcatggagagcagatggcttcgtatttc
gggcactcagtggccgtcactgacgtcaacagggacgggaggcatgacctcttggtgggc
gcgccactgtacatggagagccgtgctgaccgcaagctggccgaggtggggcgcgtgtac
ttgttcctgcagactcgaggccctcacgcgctgggcgcccccagcctcctgctgaccggc
acgcagctttatgggcgatttggctcagccattgcgcctctgggcgacctcaaccgggat
ggctacaacgatgttgctgtggccgccccctatgggggtcccagcggtcgaggccaagtg
ttggtgttcctgggtcagagtgagggacttaactcacacccttcccaggtcctggacagc
cccttccccacaggctctggctttggcttctcccttcgaggtgccacagacatcgatgac
aatggatacccagacctgctggtgggagcttacggggccaacaaggttgttgtgtacagg
gctcagccggtggtgatggccactgtccagctgctggtgcaagattcgctgaatcctgct
gtgaagaattgtgtcctgcccctgaccgagacaccagtgagctgctttaacatccagatg
tgtgtgggagccactggacacaacgttcccaagaagctgcacctaaatgctgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctactgctggcctctcaacaggcg
agcaccatcctgggcctggatctgagcggaaggcacggccccacctgccacaccaccaag
gccttcctccgagatgaggccgacttccgggacaagctgagccccatcgtgctcagcctc
aatgtgtccctgcagcctgagaaggatggactagcccctgctctcatgttgcatggagac
acccacatccaggaacagacccgcatcattctggactgtggggaagacgacctgtgtgtg
ccacagctccagctcactgccagcgtgacaggctccccgctcctcattggagccgataac
atgctgcagctgcagatggaagcggccaacgacggggagggagcctacgaggccgagctg
gctgtgcacctgcctccaggcgcacactacatgcgggccctcagcaacaccgagggcttt
gagaggatcatctgtaaccagaagagggagaatgagaccaaggtggtgctgtgtgagctg
ggcaaccccatgaagaggaacgcccagataggaatcacgatgttggtgagtgtggggaac
ctggaagaggctggggagcacgtgtccttccggctgcagatcaggagcaagaacagccag
aatccaaacagtgagatggtgatgctggatgtgccagttcgggcagaggcccatgtggag
ctgagagggaactcctttccagcctccctggtggtggcagcagaagaaagcaagagagag
aacagctcggacagctggggccccaaagtggagcacacctacgagctccacaacaatggc
cctggtgctgtaaaaggcctccgcctcaacctccgcctccccggccagtcccagccctcc
gaccttctctacatcctggatatacagccccggggaggccttcagtgctccccacaacca
tctcccaaccccctcaagctcgactgggggctgcccacctccagcccttcccaggcctat
cacaagcgggaccgcagacaggcgctcctgccggagcaggagcagccctcgaggcttcaa
ggtccagtttttgtgagctgcgattcggcgccctgtactgtggtgcagtgtgagctgcag
gagatggcgcgcgggcagcgggtcatggtcacggtgctggccttcctgtcgttgcccagc
ctccgccagaggcccctggatcagtttgtactgcagtcgcacgcttggttcaacgtctcc
tcccttccctatgccgtgcccgccctcagcctgcccagcggggaagctctggtgcagaca
cagctgcttcgggtcttggaggagagagacattccaatctggtgggtgctgctaggcgtg
ctgggtggcctgctgttgctcacgttcctggtcctggccatgtggaaggttggcttcttc
aagcggaatcggccacccttacaagaagatgacgaagaggagtga

KEGG   Delphinapterus leucas (beluga whale): 111171639
Entry
111171639         CDS       T05885                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04514  Cell adhesion molecules
dle04810  Regulation of actin cytoskeleton
dle04919  Thyroid hormone signaling pathway
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111171639 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111171639 (ITGAV)
   04514 Cell adhesion molecules
    111171639 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111171639 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111171639 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111171639 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111171639 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111171639 (ITGAV)
   05205 Proteoglycans in cancer
    111171639 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111171639 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111171639 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    111171639 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111171639 (ITGAV)
   05414 Dilated cardiomyopathy
    111171639 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111171639 (ITGAV)
   05165 Human papillomavirus infection
    111171639 (ITGAV)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    111171639 (ITGAV)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111171639 (ITGAV)
  Exosomal proteins of epithelial cells
   111171639 (ITGAV)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111171639 (ITGAV)
CD molecules [BR:dle04090]
 Proteins
  111171639 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 111171639
NCBI-ProteinID: XP_022422921
UniProt: A0A2Y9MPN9
LinkDB
Position
Unknown
AA seq 1048 aa
MASLPRRRLRLRPRRLLLLLSGFLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHRGCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQIAEIVSKYDPKVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTAK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRPTGLNAVPSQI
LEGKWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVY
PSILNQDNKTCPLPGTDLKVSCFNVRFCLKADGKGALPTKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
ATGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKESPETEEDVGPVVQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLY
ILQYDIDGPMNCTSAMEINPLRIKISNSQTTEKNDTIGGQGDRNHLITKRDLTLSEGDVH
TLGCGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLLIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttccctgccgcggcggcggctgcgccttcgcccccgccgcctcctgctccttctc
tccggattcctgctgcctctttgcggcgccttcaatctagatgtggacagtcctgcggag
tactctggccccgagggaagttacttcggcttcgcggttgatttcttcgtgcccagcgcg
tcttccaggatgtttcttctggtgggagctcccaaagcaaacactacccagcctgggatc
gtggaaggagggcaagtcctcaagtgtgactggtcttctcaccgtgggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccgttggagtttaagtcc
catcagtggtttggagcatctgtgaggtcaaaacaggataaaattttggcctgtgcccca
ctgtaccactggaggactgaaatgaaacaggagagagagcctgttggaacatgctttctt
caggatggtacaaagactgttgagtatgctccatgcagatcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagctcatttcagatcaaatagcagaa
attgtatctaaatatgaccccaaagtttatagcatcaagtataataaccagttagcaact
cggactgcacaagctatttttgatgacagttacttgggttactcagtggccgtcggagat
ttcaacggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctccttacacaattttactggtgaa
cagatggctgcatattttggattttctgtcgctgccactgacattaatggggatgattac
gcagatgtatttattggagcgcctctcttcatggatcgtggttccgatggcaaactccag
gaggtggggcaggtctcagtgtctctgcaaagagcttcgggagacttccagacagccaaa
ctgaatgggtttgaggtctttgcaaggttcggcagtgccatagcccctttgggagatctg
gaccaggacggcttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatattttcaatggaagacccacaggcttgaatgcggtaccatctcagatc
cttgaagggaagtgggctgctcggagcatgccaccaagcttcggctattcaatgaaagga
gccacggatatagacaagaatggatatccagacttaattgtaggagcttttggtgtagat
agagctgtattatacagggccagaccagttatcactgtaaacgctggccttgaagtgtat
cctagcattttaaatcaagacaataaaacctgcccactgcctgggacagatctcaaagtt
tcctgttttaatgtcaggttctgcttaaaggcagatggcaaaggagcacttcccacgaaa
cttaacttccaggtggagcttcttttggataaactcaagcaaaaaggagcaattcgacga
gcactatttctccataacaggtccccaggtcactccaagaacatgaccatctcaaggggg
ggacagatgcaatgtgaagaactaatagcatatctgcgggatgaatctgagtttagagac
aaactcactccaattactatttttatggagtatcggttggattatagaacagctgctgat
gcgacaggcttgcagcctattcttaaccaattcactcctgccaatattagtcgacaggct
catattctgcttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttctgta
gatagtgatcaaaagaagatctatattggggacgacaaccctctgaccttgattgttaag
gctcagaatcagggggaaggtgcctatgaagctgagctcatcgtttccatcccaccgcag
gccgatttcatcggggtggtccgcaacagtgaagctttagcaagactttcctgtgccttt
aagacagaaaaccaaacgcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcctagctggtcttcgtttcagtgtgcaccagcaatcagagatggatacttct
gtgaaatttgacttacaaatccaaagctccaatctttttgacaaagtaagcccggttgta
tcttacaaagttgaccttgctgttttagctgctgttgagataagaggagtctcaagtcct
gatcatatctttcttccgattccaaattgggagcacaaggagagccctgagactgaagaa
gacgttgggccagttgttcagcacatctacgagctgagaaataacggtccgagttcattc
agcaaggcaatgctaaatcttcagtggccttacaaatataacaataacactttgttgtac
atccttcaatatgatattgatgggccaatgaactgcacttcagctatggagatcaaccct
ttgagaattaagatctcaaattcgcaaacaactgaaaagaatgacacaattggtgggcaa
ggtgaccggaaccatctcatcactaagcgggatctcaccctcagtgaaggagatgtgcac
actttgggttgtggaattgctgaatgcttgaagattgtctgccaggtggggcgactagac
agaggaaagagtgcaatcctgtatgtaaagtctctgctgtggactgagacctttatgaat
aaggaaaaccagaatcattcatattctctgaagtcgtctgcttcatttaatgttatagag
tttccgtataagaaccttctaattgaggacatcttcaactccacattggttaccactaat
gtcacctggggcattcagccagcacccatgcctgtacctgtgtgggtgatcattttagca
gttctagcaggattgttgttactggctgttttggtatttgtaatgtacaggatgggcttc
tttaaacgtgtccggccacctcaagaagaacaagaaagggaacagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Delphinapterus leucas (beluga whale): 111172869
Entry
111172869         CDS       T05885                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04514  Cell adhesion molecules
dle04640  Hematopoietic cell lineage
dle04810  Regulation of actin cytoskeleton
dle05145  Toxoplasmosis
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111172869 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111172869 (ITGA6)
   04514 Cell adhesion molecules
    111172869 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111172869 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111172869 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111172869 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111172869 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111172869 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111172869 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111172869 (ITGA6)
   05414 Dilated cardiomyopathy
    111172869 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111172869 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111172869 (ITGA6)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111172869 (ITGA6)
  Exosomal proteins of breast milk
   111172869 (ITGA6)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111172869 (ITGA6)
CD molecules [BR:dle04090]
 Proteins
  111172869 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 111172869
NCBI-ProteinID: XP_022425748
UniProt: A0A2Y9N920
LinkDB
Position
Unknown
AA seq 1091 aa
MAAAGRLWLLYLSAGLLPRLGAAFNLDTREDNVIEKTGDSGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQKAKRTGGLYSCDITSRGPCPRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIAFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDLKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRSGEVGGAAYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGKGKVFIYHGSANGINTK
PTQILEGKSPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQQTITVTPNR
IDLHQKMPCGAPSGICLKVKACFEYTAKPTGYNPSITIAGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQALTLSRQKQKVCMEETLWLQENIRDKLRPIPITASVEIQEPSTRRRVNSL
PEVLPILNSNEPKSVHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPKNPTKDGDDAHEAKLVATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEITFDTTDLDINLKLETTSNQD
NLASITATARVVIELLLSVSGVAKPSQVYFGGTVIGEQAMKSEEEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEVSNGKWLLYLVKVESKGLEKIACQPQNEINFLKLKEAHNSRK
KREIAERQTDDGRKLSLFAERKYQTLNCSVNVNCVNIKCPIRGLDSKASVVLRSRLWNST
FLEEYSKMNYLDILVRASIDVTAATENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIQDEKYNDNLEKKQW
ITRWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcgactgtggctgctctacctgtcggcggggctcctgccgcggctc
ggcgccgccttcaacttggacacccgcgaggacaatgtgatcgagaaaaccggggactcc
gggagcctcttcggcttctcgctggccatgcactggcagctgcagcccgaggacaagcgg
ctgttgctcgtgggggccccacgggcagtggcccttccgctgcagaaggccaaaagaaca
ggaggcttgtacagctgcgacatcacctcccgggggccgtgcccacggattgaatttgat
aacgacgctgacccttcatcggaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaagttgtgacatgtgctcatcgatatgaaaaaaggcagcat
gttaatacaaaacaggaatcccgagacatttttggaaggtgttacgtcctaagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgtgatggccgattaaga
ggtcatgaaaaatttggttcttgccaacaaggtgtagcagctacttttactaaagacttt
cattacattgcgtttggagccccaggcacttacaactggaaagggattgttcgcgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttatttagggttt
tctttggactcagggaagggtattgtttccaaagatgagatcacttttgtatctggtgct
cctagagccaatcacagtggagctgtggttttgcttaaaagagacctgaagtctgcgcac
cttctccctgagcacatatttgacggggaagggctggcttcttcatttggctatgacgtg
gcagtggtggaccttaacaaagatgggtggcaagatatagttattggagccccacagtat
tttgatagaagtggagaagttggaggtgcagcatatgtctacattaaccagcaaggcaga
tggaataatgtcaagccaattcgtcttaatggaaccaaagattctatgtttggcattgcg
gtcaaaaatatcggtgatattaatcaagatggctacccagatattgcagtcggagcaccc
tacgatggtaaggggaaggtttttatctatcacggatctgcgaacggaataaataccaaa
ccaacacagattctcgagggtaaatcaccgttttttggatattcaattgccggaaacatg
gaccttgatagaaattcctaccccgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagcaaaccatcacagttacacctaacaga
attgatctccatcagaaaatgccctgcggggcgcctagcgggatatgcctgaaggtcaag
gcctgttttgaatatactgccaaacccactggttacaacccttcaataaccattgcgggc
acactggaggctgagaaggaaagaagaaaatctgggctgtcatcaagagttcagtttcga
aaccaaggttctgagcccaagtatacgcaggcgctcactctgagccggcagaagcagaag
gtgtgcatggaggaaaccctgtggctccaggaaaatatcagagataaactgcgtcccatc
cccataacagcttcagtagagatccaagagccgagcactcggaggcgagtgaattcgctt
ccagaagttcttccaattctgaattcaaacgaacccaagtctgttcatacagatgtacac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaagctagaatat
aaattttgtacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggacattgctttagaaataacagtgacaaac
agcccttccaacccaaagaatcccaccaaagatggtgatgacgctcatgaagctaaactc
gttgccacttttccagacactttgacttattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgcaaaccagaacggctcacaagcagactgcgagcttggg
aatccttttaaaagaaattccagtgttactttttatttaattttaagtacaactgagatc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggcttcaattacagctacagcaagagtggttattgaactgcttttatcggtctcc
ggagttgctaaaccttcccaggtgtattttggaggtacagtcattggtgagcaagctatg
aaatctgaagaggaagtgggaagtttaattgagtatgagttcagggtgattaacttgggc
aagcctcttaaaaacctcggcacagcaaccttgaatatccagtggccaaaagaagttagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagatagct
tgtcagccacaaaatgaaataaacttcctgaaactaaaggaggctcacaactcaagaaag
aaacgagaaattgctgaaagacagacagacgatggtagaaaactttctttatttgccgaa
agaaaataccagaccctcaactgcagcgtgaacgtgaactgtgtgaatatcaagtgcccg
atccgagggctggatagcaaggcctccgtggtcctgcgctcgaggctctggaacagcacg
tttctggaggagtactccaagatgaactacctggacatcctcgtgcgggcttccattgat
gtaactgctgccaccgagaatattaagctgcccaatgcgggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcaatattcaggagtaccttggtggatcatcctagtg
gctattcttgctgggattttgatgcttgctctattagtatttttactatggaagtgtgga
ttctttaaacgctctaggtacgacgatagtgttccccgataccatgctgtaaggatccgg
aaagaggagcgagagatccaagatgaaaaatataatgataaccttgaaaaaaaacagtgg
atcacaaggtggaatgaaaatgaaagctactcctag

KEGG   Delphinapterus leucas (beluga whale): 111186789
Entry
111186789         CDS       T05885                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04145  Phagosome
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04512  ECM-receptor interaction
dle04611  Platelet activation
dle04640  Hematopoietic cell lineage
dle04810  Regulation of actin cytoskeleton
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05222  Small cell lung cancer
dle05410  Hypertrophic cardiomyopathy
dle05412  Arrhythmogenic right ventricular cardiomyopathy
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111186789 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111186789 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111186789 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111186789 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111186789 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111186789 (ITGA2)
   04611 Platelet activation
    111186789 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186789 (ITGA2)
   05205 Proteoglycans in cancer
    111186789 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111186789 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111186789 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111186789 (ITGA2)
   05414 Dilated cardiomyopathy
    111186789 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111186789 (ITGA2)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111186789 (ITGA2)
  Exosomal proteins of bladder cancer cells
   111186789 (ITGA2)
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111186789 (ITGA2)
CD molecules [BR:dle04090]
 Proteins
  111186789 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 111186789
NCBI-ProteinID: XP_022453408
UniProt: A0A2Y9QD51
LinkDB
Position
Unknown
AA seq 1179 aa
MRPGRTGGTLLRLVLVLNQGILNCCVAYNVGLTEAKIFSGPSSEQFGYAVQQFINPEGNW
LLVGSPWSGFPENRMGDVYKCPVDLSTTACEKLNLQTSTSISNVTEMKTNMSLGLTLTRN
VGTGGFLTCGPLWAQQCGSQFYTTGLCSDVSPNFQLLTSFSPAVQTCPSLIDVVVVCDES
NSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANYPRVVFNLNTFKTKDEMIKATSQT
SQYGGDLTNTFKAIQYARDSAYSAAAGGRPGATKVMVVVTDGESHDGSMLKAVIDQCNDD
NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIF
SIEGTVQGGDNFQMEMSQVGFSADYSPQNDILVLGAVGAYDWSGTVVQQTPHGHLIFPKQ
AFDQILQDRNHSSYLGYSVASISTGKSVHFVAGAPRANYTGQIVLYSVNESGNITVIQSH
RGDQIGSYFGSVLCAVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGVLNWHQF
LEGPEGVENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGREGTIRLRYSQ
KILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSVGAFGQVIQLWSQSIADVSVVASFT
PEKITLLNKNAEINLKLCFSAKFRPAKQNNQVAIVYNITIDADQYSPRVTSRGLFKENNE
RCLQKTMIVNQAQSCSEYIIHIQEPSDVVSSLDLCVNISLENPGTNPALEAYSETVKVFS
IPFYKDCGDDGVCISDLVLDVQQLPAAQQQPFIVSNQNKRLTFSVTLKNKKESAYNSGIV
VDFSENLFFASWSMPVDGTEVTCQIASSQKSVTCNVGYPALKREQQVTFTINFDFNLQTL
QNQASVSFQALSESYEENKADNSVNFKFSLLYDAEIHITRSTNINFYEVSSDGNIPSIVN
NFEDIGPKFIFFIKVTTGSVPVSMASVIIHIPQYTRGKNPLMYLTGVHTDQAGDISCKAE
INPLKVGQTSSPVSFKSENFRHVKELNCRTASCSNITCWLKDLQVKGEYFLNVSTRIWNG
TFAVSTFQTVQLTAAAEINTYNPQIYAIEENTVTIPITIMKPHEKAEVPTGVIVGSAIAG
ILLLLALVAVLWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgcggccaggacggacaggcggcacactgctgcggctggtgttagtgctcaatcaaggc
attttaaattgctgtgtggcgtacaatgttggtctcacggaagcaaagatattttctggt
ccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccagaaggcaactgg
ttactggttggttcaccatggagtggctttcctgagaaccgaatgggagatgtgtataaa
tgtcctgttgatctatccaccactgcatgtgaaaaactgaatttgcaaacttccacgagc
atttccaacgttactgagatgaaaaccaacatgagccttggcttgacactgacaaggaac
gtgggaacgggaggatttcttacctgtggtcccctgtgggcacagcagtgcggaagtcag
ttttacacaaccgggttatgctctgatgtcagtcccaattttcagctcctgaccagcttt
tcacctgcagttcagacctgcccttccctcatagatgttgtggttgtatgtgatgaatca
aacagtatttacccctgggatgcagtaaagaactttttggaaaaatttgtgcaaggcctg
gatataggccccacaaagacacaggtggggttaattcaatatgccaattatccaagagtg
gtgtttaacctgaacacttttaaaaccaaagatgaaatgattaaagcaacatcccagaca
tcccagtatggtggagacctcacaaatacattcaaagcaattcagtatgcaagagattct
gcttattcagcagctgctggtggacgaccaggtgctaccaaagtcatggtggttgtaact
gatggtgaatcccatgatggttcaatgttgaaagccgtaattgatcaatgtaacgatgac
aatatactgaggtttggcatagcagttcttgggtacttaaacagaaatgcccttgatact
aaaaatttaataaaagaaattaaagcaattgccagtattccaacagaaagatactttttc
aatgtttctgatgaagcagctctactagaaaaggctgggacattaggagaacaaattttc
agcattgaaggtactgttcaaggaggagacaactttcaaatggaaatgtcacaagtggga
ttcagcgcggattactctcctcaaaatgatattctggtgctgggtgcagtaggagcttat
gactggagtgggactgttgtccagcagacacctcatggacatttgatctttcctaaacaa
gcctttgaccaaattctgcaagacagaaatcacagttcatatttaggttactctgtggct
tcaatttctactggaaaaagtgtccacttcgttgctggagctcctcgggcaaattatacc
ggccagatagtgctgtacagtgttaatgagagtggcaatatcacagttattcagtctcac
agaggtgaccagattggctcctattttggtagtgtgctgtgtgcagtcgatgtggacaaa
gacaccattacagatgtgctcttggtaggtgcgccaatgtacatgaatgacctaaagaaa
gaggaaggaagagtctacctgtttactatcacaaagggcgttttgaattggcaccaattt
ctggaaggccccgagggtgttgaaaatgctcggtttggttcagcgattgcagctctttca
gacatcaatatggatggctttaatgatgtgatcgttggctcacctttggaaaatcagaac
tctggagctgtgtacatctacaatggtcgtgagggcaccattcgcctgaggtattcccag
aaaatcttggggtctgatggagcctttaggagccacctccagtactttgggagatccctg
gatggctatggagatttaaatggggattccatcactgatgtgtctgttggtgcctttgga
caggtcattcagctctggtcacagagtattgctgatgtatctgtagttgcttcattcaca
ccagaaaaaatcactttgctcaacaagaacgctgagataaaccttaaactctgtttcagc
gccaagtttagacccgctaagcaaaacaatcaagtggccattgtatataacatcacaatt
gatgcagaccaatattcacccagagtaacctccaggggattatttaaagaaaataatgaa
aggtgcttgcagaagaccatgatagtaaatcaagcacagagttgctctgagtacatcatc
cacatacaggagccctctgatgttgtcagctctctggatctgtgtgtgaacatcagtctg
gaaaaccctggcactaaccctgcccttgaagcctactctgagacagtcaaggtcttcagt
atccctttctataaagattgtggtgatgatggagtttgcatctctgatctagttctagat
gttcaacagctgccagcagctcaacaacagcccttcattgtcagcaaccaaaataaaagg
ttaacattttcagtaacactgaaaaataaaaaggaaagtgcatacaacagtgggattgtt
gttgatttttcagaaaatctgttttttgcttcctggtccatgccggttgatgggacagaa
gtgacgtgccagattgcttcatctcagaagtctgttacctgcaatgtgggctaccctgct
ttaaaaagggaacaacaggtgactttcactattaacttcgacttcaatcttcaaaccctt
cagaatcaggcctctgtcagtttccaagccttaagtgaaagctacgaggaaaacaaggca
gataattcagtcaacttcaaattctctctgctgtatgatgccgaaattcacataacaaga
tctaccaacataaatttttatgaagtctcctcggatgggaatattccttctattgtgaac
aattttgaagatattggtccaaaattcatcttcttcattaaggtaacaacaggaagtgtt
ccagtcagcatggcatctgtaatcatccatatccctcaatacaccagaggaaagaacccg
ctgatgtacctgactggggtgcacacggaccaggctggtgacatcagttgcaaagctgaa
ataaatccactgaaagtaggacaaacatcttctcctgtatctttcaagagtgaaaatttc
cgtcatgtaaaagaattgaactgcagaaccgcttcatgtagtaacatcacctgctggctg
aaagaccttcaggtgaaaggagaatacttccttaatgtgtctaccagaatctggaacggg
actttcgcagtatcgacttttcagacagtacagctgacagcagcagcagaaatcaacacc
tataaccctcagatatatgcgatcgaagaaaacaccgtcacgattcccattaccataatg
aaaccccacgagaaagctgaagtaccaactggagttatagtaggaagtgcaattgctgga
atccttttgttattagctctggttgcagttttatggaagcttggattcttcaaaagaaaa
tatgaaaaaatgaccaaaaatccagatgaaattgatgagaccacagaactcaacagctga

DBGET integrated database retrieval system