KEGG   Delphinapterus leucas (beluga whale): 111166398
Entry
111166398         CDS       T05885                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05221  Acute myeloid leukemia
dle05226  Gastric cancer
dle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166398 (JUP)
   05202 Transcriptional misregulation in cancer
    111166398 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    111166398 (JUP)
   05221 Acute myeloid leukemia
    111166398 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111166398 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111166398 (JUP)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111166398 (JUP)
SSDB
Motif
Pfam: Arm HEAT Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 Arm_2
Other DBs
NCBI-GeneID: 111166398
NCBI-ProteinID: XP_022413768
UniProt: A0A2Y9LWI5
LinkDB
Position
Unknown
AA seq 744 aa
MDVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGVTEDDEACERQYMLKKTTT
YTQAVPQSQGDLDYQMSTTGRAKRVREAICPGVTREDSSLLATQVEGQATNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRAMQNTSDLDTARCTTSILHNLSHHREGLLSIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKVVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVHIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
NSKNKMLVTQNSGVEALIHAILCAGDKDDITEPAICALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
MAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEVFRLNTIPLFVQLLHSSVENIQ
RVAAGVLCELAQDREAADAIDAEGASAPLMELLHSHNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQSMIPINESYADDMDATYRPMYSSDVPLDPLEMHMDMD
GDYPIDTYSDGLRPPYPTADRMLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggacgtgatgaacctgatcgaacaacccatcaaggtgaccgagtggcaacagacgtac
acctacgactcgggcatccactcgggggtcaatacctgcgtgccctcggtcagcagcaaa
ggcgtcacggaggatgacgaggcctgtgagcgccagtacatgctgaagaagaccaccacc
tacacccaggcggtgccccagagccaaggtgacctggattaccagatgtccacgacaggc
agagccaagcgggtgcgggaggccatatgtcctggtgtgacgagagaggacagctccctg
ctggccacccaggtggagggacaggccaccaacctgcagcggctggccgagccatcccag
ctcctgaagtcggccatcgtgcatctcatcaactaccaggacgacgccgagctggccacc
cgggcccttcctgagctcaccaaactgctcaacgatgaggacccggtggtggtgaccaag
gcggccatgatcgtgaaccagctgtcgaagaaggaggcgtctcggcgggcgctgatgggc
tcgccccagctggtagcagccgtcgtgcgcgccatgcagaacaccagcgacctggacaca
gcccgctgtaccaccagcatccttcacaacctctcccaccaccgtgaggggctgctttcc
atcttcaagtcgggtggcatccctgccctggtccgcatgctcagctcccccgtggagtcg
gtccttttctacgccatcaccacgctacacaacctgctgctctaccaggagggcgccaag
atggcggtgcgcctggcagacgggctccagaaggtcgtgcctctgctcaacaagaacaac
cccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccaggag
agcaagctcatcatcctggccaacggaggaccccaggctctcgtgcacatcatgcgcaac
tacagttacgagaagctgctctggaccaccagccgtgtgctcaaggtgctgtccgtgtgt
cccagcaataagcccgctatcgtggaggctggtgggatgcaggccctgggcaaacacctg
acgagcaacagcccccgcctcgtgcagaactgcctctggaccctgcgcaacctctcggac
gtggccaccaagcaggagggcctggagagtgtgttgaagattctggtgaaccagctgagc
gtggacgacgtcaatgtcctcacctgtgccacgggcactctgtccaacctgacctgcaac
aacagcaagaacaagatgctggtgacgcagaacagcggcgtggaggcgctcatccatgcc
atcctgtgtgccggtgacaaggatgacatcacagagcccgccatctgtgccctgcgccac
ctcaccagccgccaccccgaggccgagatggctcagaactccgtgcgcctcaactacggc
atcccggccatcgtcaagctgctcaaccagcccaaccagtggccgctggtcaaggcaacc
atcggcctgatcaggaatctggccctgtgcccagccaaccatgccccactgcaggaggca
gcggtcattccccgcctcgtccagctgctggtcaaggcccaccaggatgcccagcgccac
atggctgcaggcacacagcagccctacacagacggcgtgaggatggaggagatcgtggaa
ggctgcaccggagccctgcacatcctcgcccgggatcccatgaaccgcatggaggtcttc
cgactcaacactatccccctgtttgtgcagctcctgcactcctcagtggagaacatccag
cgtgtggccgccggggtgctgtgcgagctggcccaggacagggaggcggccgacgccatt
gatgctgagggggcctcagccccactcatggagctactgcactcccacaatgagggcacc
gccacctacgctgctgctgtcttgttccgcatctccgaggacaagaacccagattaccga
aagcgtgtgtctgtggagctcaccaactccctcttcaagcacgaccctgcggcctgggag
gctgcccagagcatgatccccattaatgaatcctacgcagatgacatggatgccacctac
cgccccatgtactcgagtgacgtgcccctggaccccctggagatgcacatggacatggat
ggggactatcccattgacacctacagcgacggcctcaggcccccctaccccactgcggac
cgcatgctggcctag

DBGET integrated database retrieval system