KEGG   Delphinapterus leucas (beluga whale): 111166403
Entry
111166403         CDS       T05885                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle04657  IL-17 signaling pathway
dle05144  Malaria
dle05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166403 (CSF3)
   04151 PI3K-Akt signaling pathway
    111166403 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111166403 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111166403 (CSF3)
   04657 IL-17 signaling pathway
    111166403 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111166403 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    111166403 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111166403 (CSF3)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111166403 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL23 IL6
Other DBs
NCBI-GeneID: 111166403
NCBI-ProteinID: XP_022413779
UniProt: A0A2Y9LVQ5
LinkDB
Position
Unknown
AA seq 195 aa
MKLMALQLLLWHSALLTVQEATPLGPASSLPQSFLLKCLEQVRKIQADGAELQERLCTTH
KLCHPEELVLLGHSLGIPQASLSSCSSQTLQLTACLSQLHGGLFLYQGLLQALAGISPEL
APTLDILQLDVTDFATNIWLQMEDLGVAPAVQPTQGPMPTFTSAFQRRAGGVLVASKLQS
FLELAYRVLRYLAEP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgatggccctgcagctgctgctctggcacagtgcactcttgacggtgcaagaa
gccacacccctcggccctgccagctccctgccccagagcttcctgcttaagtgcttagag
caagtgaggaaaatccaggctgatggcgctgagctgcaggagaggctgtgcaccacccac
aagctgtgccaccctgaggagctggtgctgcttgggcactctctgggcatcccccaggct
tccctgagtagctgctccagccagaccctgcagctgacagcctgcctgagccaactgcac
ggcggcctcttcctctaccagggcctcctgcaggccctcgcggggatctccccagagttg
gcccccaccttggacatactgcagctggacgtcaccgactttgccaccaacatctggctg
cagatggaagacctgggggtggcccctgccgtgcagcccacccagggccccatgccgacc
ttcacctcagccttccagcgccgggcaggaggggtcctggttgcttccaagctgcagagc
ttcctggagctcgcgtaccgtgtcctgcgctacctggccgagccctga

KEGG   Delphinapterus leucas (beluga whale): 111173147
Entry
111173147         CDS       T05885                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111173147 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111173147 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111173147 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111173147 (THPO)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111173147 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111173147
NCBI-ProteinID: XP_022426252
UniProt: A0A2Y9N4B7
LinkDB
Position
Unknown
AA seq 324 aa
MEMTELLLVVMPLLTARLTLSSPAPPACDPRLLNKLLRDSHVLHSRLEQTKAQDVLGAST
LLLEAVMAARGQLGPTCLSSLLVQLSGQVRLLLGALQGLLGTQLSAQGRTTAHKDPSAIF
LSFQRLLRGKVRFLLLVVGPTLCAKRAPPTTAIPGNTSPFLILNKLPNRTSGLLETNSSV
SARTTGSGLLNRLQGSRAKIPGLLNQTSRSLDQIPGHLNGTHGPLSGIHGLFPGPTPRAL
RAPDIPPETSDMDSLPPYLQPGESPSPAHPPPGQYTLFSPSPTLPIPTVQLQPMLPDPSA
ITPNSTSRLLVAAHSHFRNLSQEE
NT seq 975 nt   +upstreamnt  +downstreamnt
atggagatgactgaattgctcctcgtggtcatgcctctcctaactgcaagactaactctg
tccagcccggctcctcctgcctgtgacccccgactcctaaataaactgcttcgtgactcc
catgtccttcacagcagactggaacagaccaaggcacaggacgttctgggagcctcgacc
cttctgctggaggcagtgatggcagcgcggggacaactgggacccacttgcctctcatcc
ctactggtgcagctttctggacaggtccgcctcctccttggggccctgcagggcctccta
ggaacccagctttctgcgcagggcaggaccacagctcacaaggatcccagtgccatcttc
ctgagcttccaacgactgctccgaggaaaggtgcgtttcctgctgcttgtagtgggaccc
accctctgtgccaagcgggccccacctaccacagctatcccggggaacacctctccattt
ctcatactgaacaagctcccaaacaggacttctggattgttggagacaaactccagtgtc
tcagccagaactactggctctggacttctgaacaggctgcagggatccagagccaagatt
cctggtctgctgaaccaaacctccaggtccctagaccaaatccctggacacctgaacggg
acacatggacccctgagtggaattcacggactctttcctggacccacacccagggcccta
agagccccggatattcctccggaaacttcagacatggactccctgccaccctacctccag
cctggagagtctccttccccagcccatcctcctcctggacagtacacactcttctctcct
tcacccaccttgcccatccccacggtccagctccaacccatgcttcctgacccctctgct
atcacacccaactctaccagtcgtcttctagttgcagcccactctcacttccggaatctg
tctcaggaagagtaa

KEGG   Delphinapterus leucas (beluga whale): 111181274
Entry
111181274         CDS       T05885                                 

Gene name
PRL
Definition
(RefSeq) prolactin isoform X1
  KO
K05439  prolactin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111181274 (PRL)
   04151 PI3K-Akt signaling pathway
    111181274 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111181274 (PRL)
   04060 Cytokine-cytokine receptor interaction
    111181274 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111181274 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111181274 (PRL)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111181274 (PRL)
SSDB
Motif
Pfam: Hormone_1 KIAA1430
Other DBs
NCBI-GeneID: 111181274
NCBI-ProteinID: XP_022442207
UniProt: A0A2Y9PG47
LinkDB
Position
Unknown
AA seq 230 aa
MDNKGSSQKAGSLLLLLLLVSNLLLCKSVASLPICPSGAVNCQVSLRDLFDRAVILSHYI
HNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQVHHEVLLSMILGVLR
SWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGVKENEVYSV
WSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDSYLKLLKCRIIYDSNC
NT seq 693 nt   +upstreamnt  +downstreamnt
atggacaacaaaggttcatcacagaaagcagggtcactcctgctcctgctgttgctggtg
tcaaatctgctcttgtgcaagagtgtggcctcccttcccatctgtcccagcggggctgtc
aactgccaggtgtcccttcgagacctgtttgaccgcgcagtcatcctgtcccactacatc
cataacctctcctcggaaatgttcaacgaatttgataaacggtacgcccagggcagaggg
ttcattaccaaggctatcaacagctgccacacctcctccctctccacccctgaagacaaa
gaacaagcccaacaggtccatcatgaagtccttctgagcatgatccttggcgtgctgcgc
tcctggaatgaccctctgtaccacctggtcactgaggtgcggggtatgcaagaagcccca
gatgctatcctatcaagagccatagagattgaagaacagaacaaacgacttctagaaggc
atggagaagatagttggccaggttcatcctggagtcaaggagaatgaggtctactcggtg
tggtcgggacttccatccctgcagatggccgatgaagatacgcgcctttttgctttttat
aacctgctccactgcctacgcagggattcacataagattgacagttatctcaagctcctg
aagtgccgaatcatctacgacagcaactgctaa

KEGG   Delphinapterus leucas (beluga whale): 111182312
Entry
111182312         CDS       T05885                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04066  HIF-1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182312 (EPO)
   04066 HIF-1 signaling pathway
    111182312 (EPO)
   04151 PI3K-Akt signaling pathway
    111182312 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111182312 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111182312 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111182312 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182312 (EPO)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182312 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111182312
NCBI-ProteinID: XP_022444347
UniProt: A0A2Y9PM33
LinkDB
Position
Unknown
AA seq 193 aa
MGVRECPARLLLLSLLLLPLGLPVLGAPPHLICDSRVLERYILEAREAENATVGCAEGCS
FSENITVPDTKVNFYAWKRMEVQQQAVEVWQGLALLSEAILQGQALLANSSQPSEALQLH
VDKAVSGLRSLTSLLRALGAQKGAVPLPDAASSAAPLRTFTVDTLCKLFRIYSNFLRGKL
TLYTGEACRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgccctgcccggctgcttctgctgtccttgctgctgcttcctctg
ggcctcccagtcctgggcgcccccccacacctcatctgtgacagccgagtcctggagagg
tacatcctggaggccagggaggccgaaaatgccacggtgggctgtgctgagggctgcagt
ttcagcgagaacatcactgtcccagacaccaaggttaacttctatgcctggaagaggatg
gaggtccagcagcaggctgtggaagtctggcagggcctggccctgctctcagaagccatc
ctgcagggccaggccctgttggccaactcgtctcagccatccgaggccctgcagctgcac
gtggacaaagctgttagcggcctgcgaagcctcacctccctgcttcgggcactgggagcc
cagaagggagccgtcccccttccagacgcagcctcctctgcagccccgctccgaacattc
actgttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggaaagctg
acgctatacacaggggaggcctgcaggagaggggacaggtga

KEGG   Delphinapterus leucas (beluga whale): 111182618
Entry
111182618         CDS       T05885                                 

Definition
(RefSeq) somatotropin isoform X1
  KO
K05438  growth hormone
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04630  JAK-STAT signaling pathway
dle04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182618
   04151 PI3K-Akt signaling pathway
    111182618
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111182618
   04060 Cytokine-cytokine receptor interaction
    111182618
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111182618
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182618
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182618
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 111182618
NCBI-ProteinID: XP_022444852
UniProt: A0A2Y9PPX0
LinkDB
Position
Unknown
AA seq 262 aa
MYKENRWGQRERRGQRIKTAHKGPIPGPQDPSPQTAQGPVDSSPAVMAAGPRTSMLLAFA
LLCLPWTQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNTQ
AAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRV
YEKLKDLEEGIQALMQELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDL
HKAETYLRVMKCRRFVESSCAF
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtataaagaaaataggtgggggcagagagagagaagaggccagcgtataaaaacggcc
cacaagggaccaattccaggaccccaggacccatctccccagacagctcagggtcctgtg
gacagctcaccagctgtgatggctgcaggccctcggacctccatgctcctggctttcgcc
ctgctctgcctgccctggactcaggaggtgggcgccttcccagccatgcccttgtccagc
ctgtttgccaacgctgtgctccgggcccagcacctgcaccaactggcggctgacacctac
aaagagtttgagcgcgcctacatcccggagggacagagatactccatccagaacacccag
gctgccttctgcttctcggagaccatcccggcccccacaggcaaggacgaggcccagcag
agatcggacgtggagctgctccgcttctcgctgctgctcatccagtcgtggctcgggccc
gtgcagttcctcagcagggtcttcaccaatagcctggtgtttggcacctcggaccgcgtc
tatgagaagctgaaggacctggaggagggcatccaggccctgatgcaggagctggaagat
ggcagcccccgggctgggcagatcctcaagcagacctacgacaaatttgacacaaacatg
cgcagtgatgacgcgctgctcaagaactacgggctgctctcctgcttcaagaaggacctg
cacaaggctgagacgtacctgcgggtcatgaagtgtcgccgcttcgtggagagcagctgt
gccttctag

KEGG   Delphinapterus leucas (beluga whale): 111182801
Entry
111182801         CDS       T05885                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04080  Neuroactive ligand-receptor interaction
dle04152  AMPK signaling pathway
dle04630  JAK-STAT signaling pathway
dle04920  Adipocytokine signaling pathway
dle04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111182801 (LEP)
   04152 AMPK signaling pathway
    111182801 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111182801 (LEP)
   04060 Cytokine-cytokine receptor interaction
    111182801 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111182801 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111182801 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111182801 (LEP)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111182801 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 111182801
NCBI-ProteinID: XP_022445241
UniProt: G8DLG4
LinkDB
Position
Unknown
AA seq 167 aa
MRCGPLCRFLWLWPYLSYIEAVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGL
DFIPGLTPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLP
QARALETLESLGGVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgttgtggacccctgtgccgattcctgtggctttggccctatctgtcctacattgaa
gctgtgcccatccgaaaagtccaggatgacaccaaaacgctcatcaagacgattgtcacc
aggatcaatgacatatcacacacgcagtccgtctcctccaaacagagggtcactggtttg
gacttcatccctgggctcacccctgtcctgagtttgtccaagatggaccagacattggcg
atctaccaacagatcctcaccagtctgccttccagaaatgtgatccaaatatctaatgac
ctggagaacctccgggaccttctccacctgctggcctcctccaagagctgccccttgccc
caggccagagccctggagaccttggagagcctgggcggcgtcctggaagcctccctctac
tccacggaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgcggcag
ctggacctcagccctgggtgctga

KEGG   Delphinapterus leucas (beluga whale): 111183926
Entry
111183926         CDS       T05885                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111183926 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111183926 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111183926 (CNTF)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  CSF and other factors
   111183926 (CNTF)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 111183926
NCBI-ProteinID: XP_022447619
UniProt: A0A2Y9PL17
LinkDB
Position
Unknown
AA seq 200 aa
MAFTEYSPLTPRRRDLCSRSVWLARKIRSDLTALMESYVKHQGLNENVNLDSVRGVPVAS
TDRWSELSEAERLQENLQAYRTFHVMLARMLEDQRVHFTPAEDDFHQAIHTVLLQVAAFA
YQLEELMVLLEHKIPSSEADGMPLIVGDGGLFEKKLWGLKVLQELSQWTVRSVHDLRVIS
SCQTGIPGRGSHYTAKDKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcacagagtattcaccgctgacccctcgccgccgggacctctgtagccgctct
gtctggctagcaaggaagatccgttcagacctgactgctcttatggaatcttatgtgaag
caccaaggtctgaacgagaacgtaaacctggactctgtgcgtggtgtgccagtggcaagc
actgatcggtggagcgagcttagtgaggcagagcgactccaagagaacctccaagcttac
cgtaccttccatgttatgttggccagaatgttagaagaccaacgggtgcattttactcca
gctgaagatgacttccatcaagcaatacataccgttctcctccaagtcgctgcctttgct
taccagctggaagaattaatggtgctcctggaacacaagattccttccagtgaggctgat
gggatgccccttattgttggagatggtggtctctttgagaagaagctctggggcctaaag
gtgctgcaagagctttcacagtggacagtgaggtccgtccatgaccttcgagtcatttca
tcttgtcaaactgggatcccaggacgtgggagccattatactgctaaggacaagaaaatg
tag

DBGET integrated database retrieval system