KEGG   Delphinapterus leucas (beluga whale): 111166431
Entry
111166431         CDS       T05885                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00052  Galactose metabolism
dle00500  Starch and sucrose metabolism
dle01100  Metabolic pathways
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
dle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111166431 (G6PC)
   00052 Galactose metabolism
    111166431 (G6PC)
   00500 Starch and sucrose metabolism
    111166431 (G6PC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111166431 (G6PC)
   04151 PI3K-Akt signaling pathway
    111166431 (G6PC)
   04152 AMPK signaling pathway
    111166431 (G6PC)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111166431 (G6PC)
   04922 Glucagon signaling pathway
    111166431 (G6PC)
   04920 Adipocytokine signaling pathway
    111166431 (G6PC)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111166431 (G6PC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111166431 (G6PC)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111166431 (G6PC)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 111166431
NCBI-ProteinID: XP_022413814
UniProt: A0A2Y9LVU4
LinkDB
Position
Unknown
AA seq 357 aa
MEEGMNALHDFGVQSTHYLQVNYQKSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNIILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFRHIRSIYSANLKKYFLITLFLFSFAIGFYLLLKGLGVDLLWTLEK
AKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLSCIV
ASLVLLHLFDSLKPPSHIELIFYVLSFCKSAAVPLASVSLIPYCLAQVLGQPNKKTL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggagggaatgaatgctctgcacgattttggggtccagtcaacgcactacctccag
gtgaattatcagaagtcccaggattggttcatcttggtgtccgtgatcgcagacctcagg
aatgccttttatgtcctcttccccatctggttccatctccgagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgcccatactggtgggtcctggacactgactactacagcaacacctctgtgccg
ctgataaagcagttcccggtcacctgtgagaccggcccagggagtccctctggccatgcc
atgggtacggcaggtgtatactatgtgatggtcacatctaccctctctatctttcgggga
aagaaaaagccaacctacagatttcggtgcttgaacatcattttgtggttgggattctgg
gcagtgcagctgaatgtctgtctttcgcgaatctaccttgctgctcattttccccatcaa
gttgttgctggagtcttgtcaggcattgcggttgctgagactttccgccacatccggagc
atctacagcgccaatctcaagaaatactttctcattaccttattcctgttcagttttgcc
attggattttacctgctgctaaaggggctgggggtcgacctcctgtggaccctagagaaa
gccaagcgaaggtgtgagcggccagagtgggtccacattgacactacgccctttgccagc
ctcctcaagaacctggggacactctttggcctgggtctggctctcaactccagcatgtac
agggagagctgcaaaggcaagcttagcaagtggttcccgttccgcctcagctgcattgtg
gcctccctcgtcctcctgcatctctttgactctttgaaacccccatcccacatcgagctg
atcttctatgtcctgtccttctgcaagagtgcagcagtgcccctggcgtctgtcagtctc
atcccctactgcctggcccaggtcctgggccagccgaacaagaagactttgtaa

KEGG   Delphinapterus leucas (beluga whale): 111170188
Entry
111170188         CDS       T05885                                 

Gene name
G6PC3
Definition
(RefSeq) glucose-6-phosphatase 3 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00052  Galactose metabolism
dle00500  Starch and sucrose metabolism
dle01100  Metabolic pathways
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
dle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111170188 (G6PC3)
   00052 Galactose metabolism
    111170188 (G6PC3)
   00500 Starch and sucrose metabolism
    111170188 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111170188 (G6PC3)
   04151 PI3K-Akt signaling pathway
    111170188 (G6PC3)
   04152 AMPK signaling pathway
    111170188 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111170188 (G6PC3)
   04922 Glucagon signaling pathway
    111170188 (G6PC3)
   04920 Adipocytokine signaling pathway
    111170188 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111170188 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111170188 (G6PC3)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111170188 (G6PC3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 111170188
NCBI-ProteinID: XP_022420784
UniProt: A0A2Y9MEU5
LinkDB
Position
Unknown
AA seq 346 aa
MESTLGAGIAMAEALQNQLPWLENVWLWVTFLGDPKSLFLFYFPVAYYASRRVGIAVLWI
SLITEWLNLVFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTAISSQVATRTHSRWVRVIPSLAYCTFLLAVGLSRVFLLAHFPHQVLAGLITGA
VLGWLMTPRVPTERELSFYGLTSLALLLGASLIYWTLFTLGLDLSWSINLASKWCERPEW
VHLDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAYLGHGQKLACLVLAMGLLGPLDWL
GYPPQISLFYIFNFLKYTLWPCLVLALVPWLVHTFSAQEAPPIRSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccacgctgggcgcgggcatcgccatggccgaggcgctgcagaaccagctgccc
tggttggagaacgtgtggctctgggtcacctttctgggcgaccccaagagcctctttctg
ttctacttccccgtggcttactacgcctctcgccgggtgggcatcgcagtgctctggatc
agcctcatcaccgagtggctcaacctcgtcttcaagtggtttctgtttggagataggccc
ttttggtgggtccatgagtctgggtactacagccaggctccagcccaggttcaccagttc
ccctcttcttgtgaaactggtccaggcagcccttccggacactgtatgatcacaggagca
gccctttggcccataatgacggccatctcttcccaagtggccactcggacccacagccgc
tgggtgagggtgatacctagcttggcttattgcaccttcctgctggcggtcggcttgtcc
cgggtcttcctcttagcacatttccctcaccaggtgttggctggcctaataactggtgct
gtcctgggctggctgatgaccccccgggtgcccacggagcgggagctaagcttctacggg
ttgacctcactggccctcttgctgggtgccagcctcatctattggacgctctttacactg
ggcctggatctttcttggtccatcaacctagcctctaagtggtgtgaacggcctgagtgg
gtgcacttggacagccggccctttgcctctctgagccgcgactcaggggccgccctgggt
ctgggcatcgcccttcactccccctgctatgcccaggtgcggcgggcatacctgggacat
ggccagaagctagcctgccttgtgttggccatggggctgctgggccccctggactggctg
ggctacccccctcagatcagccttttctacatcttcaatttcctcaagtacaccctctgg
ccatgcctggtcctggccctcgtgccctggctggtgcacacattcagtgcccaggaagca
ccacccatccgctcttcctga

KEGG   Delphinapterus leucas (beluga whale): 111172957
Entry
111172957         CDS       T05885                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00052  Galactose metabolism
dle00500  Starch and sucrose metabolism
dle01100  Metabolic pathways
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04152  AMPK signaling pathway
dle04910  Insulin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04922  Glucagon signaling pathway
dle04931  Insulin resistance
dle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111172957 (G6PC2)
   00052 Galactose metabolism
    111172957 (G6PC2)
   00500 Starch and sucrose metabolism
    111172957 (G6PC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111172957 (G6PC2)
   04151 PI3K-Akt signaling pathway
    111172957 (G6PC2)
   04152 AMPK signaling pathway
    111172957 (G6PC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111172957 (G6PC2)
   04922 Glucagon signaling pathway
    111172957 (G6PC2)
   04920 Adipocytokine signaling pathway
    111172957 (G6PC2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    111172957 (G6PC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111172957 (G6PC2)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     111172957 (G6PC2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 111172957
NCBI-ProteinID: XP_022425890
UniProt: A0A2Y9MVI0
LinkDB
Position
Unknown
AA seq 355 aa
MDFLHRNGVLIIQHLQKDYRAYYSFLNFMSNVGDPRNIFSIYFPLWFQLNQAVGTKMIWV
AVVGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALGHTITRMDKSFTTLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPRIQTASLSTYLKTNLFLFLFALGFYLLLRLLDIDLLWSVPVAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLRSCRGENGYRLSFRLLCTLAS
LTTLQLYHFVKIPTHTEYLFYMLSFCKSASIPLTVVALIPYCIHMLMKPSEKKIN
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcataggaatggagtgctcattattcagcatttgcagaaggactaccga
gcttactacagttttctaaattttatgtctaatgttggagatccccggaatatcttttct
atttattttccactttggtttcaacttaatcaggcagttggaaccaagatgatatgggta
gcagtcgttggggattggttcaatcttatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacgtgtgaaacaggtccaggaagtccatctggccacgcaatgggctcatca
tgtgtctggtatgtcatggtgacagctgccctgggccacaccatcactcggatggataag
tcattcaccactctgcacagactcacctggtcatttctttggagtcttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgcttgtggcagaggcctttgaacacactccaaggatccaa
acggccagcctgagcacatacttgaagaccaacctcttcctcttcctgtttgcacttggc
ttttacctgcttctcagactgcttgacattgacctgctgtggtctgtgcccgtagccaag
aagtggtgtgccaaccccgactggatccacattgacaccacgccttttgctggactcgtg
agaaaccttggggtcctctttggcttgggctttgcaatcaactcggagatgttccttagg
agctgcagaggggaaaacggctataggctgagcttccggctgctctgcaccctggcctcg
ttgaccacactgcagctctaccatttcgtcaagatcccgactcacaccgagtatttattt
tacatgctgtctttctgtaaaagtgcgtccatcccactgactgtggttgccctgattccc
tactgtattcatatgttaatgaaaccaagtgaaaaaaagattaattag

DBGET integrated database retrieval system