KEGG   Delphinapterus leucas (beluga whale): 111166554
Entry
111166554         CDS       T05885                                 

Gene name
NOTCH3
Definition
(RefSeq) neurogenic locus notch homolog protein 3 isoform X1
  KO
K20995  Notch 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04330  Notch signaling pathway
dle04371  Apelin signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04919  Thyroid hormone signaling pathway
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111166554 (NOTCH3)
   04371 Apelin signaling pathway
    111166554 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166554 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111166554 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166554 (NOTCH3)
   05206 MicroRNAs in cancer
    111166554 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    111166554 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111166554 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111166554 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Notch Ank NODP DUF3454 NOD Ank_5 Ank_3 Ank_4 cEGF FXa_inhibition EGF_3
Other DBs
NCBI-GeneID: 111166554
NCBI-ProteinID: XP_022414078
UniProt: A0A2Y9M9I9
LinkDB
Position
Unknown
AA seq 2336 aa
MGPGPRGRRRRRLMSPPPPLPSVRTLPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPSR
EAACLCPPGWVGERCQLEDPCHSGPCAGHGVCQSSVVAGTARFSCRCPRGFRGPDCSLPD
PCLSSPCAHGARCSVGSDGRYVCSCPPGYQGRSCRSDVDECRMGGPCRHGGTCLNTPGSF
RCQCPAGYTGPLCESPLVACAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCP
GHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCV
CVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCH
EDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR
GYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNG
GVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTV
CEHNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLV
DKYLCRCPPGTTGVNCEVNIDDCASNPCTFGICRDSINRYDCVCQPGFTGPLCNVEINEC
ASSPCGEGGSCVDGENGFQCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCVCE
LGWSGPQCSQSLARDACESHPCWAGGTCTSDGTGFRCTCPPGVQGRQCELLSPCTPNPCE
HGGYCESAPGQPAVCSCPPGWQGSRCQQDVDECAGPSPCGPHGTCANLAGSFSCTCHEGY
SGSSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGPGTC
TDHVASFTCTCPPGYGGFLCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRLGYTGTHCQH
EADPCLSRPCLHGGICAAAHPGFRCACPEGFTGAQCQTLVDWCSRTPCQNGGHCARTGAS
FYCLCPSGWSGRLCDIQSLPCREAAAQIGVPLEQLCQAGGQCVDKDSSHYCVCPEGHTGS
HCEREVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTSDNCEDDMDECASQPCQHGGVCID
LVARYLCSCPPGTLGVLCEINEDDCGPGPALDPGPRCLHNGTCVDLVGGFRCTCPPGYTG
LRCEADINECRPGACHAAHTRDCLQDPGGGFHCLCHAGFTGPHCQTVLSPCESQPCQHGG
QCHPSPGAGGALTFSCHCVPPFSGPRCERVARSCWELQCPVGVPCQQTVRGPRCACPPGL
SGPACRGSRGSPLGAANASCVTSPCLHGGSCRPETLAPFFRCACASGWAGPRCEIPAAVP
EAPEEPSCPRAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVSDPWRQCAALQCWLLFNN
SRCDPACSSPACLYDNFDCRAGGRERNCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CAGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDENGQAMVFPYH
RPGPGSESRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVER
LDFPYPLRAARGEPLELPEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEG
FALHKDAAAGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGV
GAEDAVDCRQWTQHHLVAADIRVAPATALTPPQGDADADGMDVNVRGPERPCAHLPCDTL
LVPADGFTPLMLASFCGGALEAIPAEEDEAEDTSASIISDLICQGAQLGARTDRTGETAL
HLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARM
ADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGA
NKDMQDSKEETPLFLAAREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRL
LDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKVAQSGGKKSRRPPGKAGLGPQGTRGRGKK
LTLACPGPLAESSVTLSPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGA
GRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGNPVS
PQERPPPYLAAPGHGDEFPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSL
SDWSDSTPSPATATGATAAGTLSAQPLPLSVPGPLAQSQTQLGSQPEVTPKRQVLA
NT seq 7011 nt   +upstreamnt  +downstreamnt
atggggccggggccccggggccgccgccgccgtcgcctgatgtcgccgccgccacccctg
ccgtccgtgcggacgctgcccttattgctactgctagcggggccgggggctgcagcgccc
ccttgcctggatggaagcccgtgtgcgaatggaggtcgctgcacccagctgccctcccgg
gaggctgcctgcctgtgcccaccaggctgggtgggtgaacggtgtcagctggaagacccc
tgccattccggcccctgtgctggccatggtgtctgccagagctcggtggtggcaggcacc
gcccggttctcctgccgctgcccccgtggcttccgaggcccagactgctccctgccagac
ccctgcctcagcagcccctgtgcccatggtgcccgctgctcggtgggctccgatggccgc
tacgtctgctcctgcccacccggctaccagggccgcagctgccgaagcgacgtggatgag
tgccggatgggcggaccctgccgccatggtggcacctgtctcaacacacctggctccttc
cgctgccagtgcccagctggctacacagggccactgtgtgagagccccttggtggcctgt
gccccctcgccgtgccgtaacgggggcacctgtagacagagtggcgacctcacctacgac
tgtgcctgccttcctgggttcgagggccagaactgtgaagtgaatgtggacgactgtcca
gggcaccgatgtctaaatggggggacgtgtgtggacggtgtcaacacctacaactgccag
tgccctcctgagtggacaggccaattctgtacggaggacgtggacgagtgtcagctccag
cccaacgcttgccacaatgggggcacttgcttcaacacgctgggtggccacagctgtgtg
tgtgtcaatggctggacaggcgagagctgcagtcagaatattgatgactgtgccacggcc
gtgtgcttccatggggccacctgccatgaccgtgtggcctccttctactgtgcctgcccc
atgggcaaaactggacttctgtgtcatctggatgacgcctgcgtcagcaacccctgtcac
gaggatgctatctgcgacacgaacccggtgaacggcagggccatctgcacctgtccacct
ggcttcacaggcggggcttgtgaccaggacgtggatgagtgttccatcggtgccaaccct
tgtgagcacctgggccggtgcgtgaacacacagggctcattcctgtgccagtgcggccgt
ggctacactggtccgcgttgcgagaccgatgtcaatgagtgcctctccggcccctgccgc
aaccaggccacgtgcctcgaccgtataggccagtttacctgcatctgcatggcaggcttc
acaggcacttattgtgaggtggacatggacgagtgtcagagcagcccgtgtgtcaacggc
ggggtctgcaaggacagagtcaatggcttcagctgcacctgcccctcgggcttcagcggg
gctatgtgtcagctggacgtggatgaatgcgccagcacaccctgccggaatggagccaag
tgcgtggaccagccggatggctatgagtgccgctgcgcagagggcttcgagggcacggtg
tgtgagcacaacgtggatgactgctcgccagacccatgccaccatgggcgctgtgtggat
ggcatcgccagtttctcgtgcgcttgtgccccgggctacaccggcacgcgctgtgaaagc
caggtggacgagtgccgaagccaaccctgccgccacggtggcaaatgcctagacctggtg
gacaaatacctctgccgctgccctcccggcaccacaggtgtgaactgtgaggtgaacatt
gatgattgtgctagcaacccctgcacctttggaatctgccgggacagcatcaaccgctat
gactgtgtctgccagcctggcttcacagggcctctctgcaacgtggagatcaacgagtgt
gcgtccagcccatgcggtgaggggggctcctgcgtggatggtgaaaatggcttccaatgc
ctctgcccacctggctccctgcccccgctctgtcttcccccaagccatccctgcgcccaa
gaaccctgcagtcatggcgtctgccacgacgcgcctggagggttccgctgcgtgtgtgag
cttggctggagtggccctcagtgcagtcagagcctcgctcgagatgcctgtgaatcccat
ccctgctgggcaggcggcacctgcaccagtgatggaacgggcttccgctgtacctgtccc
cctggtgtccagggccgtcagtgtgagctgctgtccccctgcaccccaaatccctgtgaa
catgggggctactgtgagtctgcccctggccagccggctgtctgctcctgcccccctggt
tggcaaggctcacgatgtcagcaggacgtggatgaatgtgctggcccctcaccctgtggt
ccccatggtacctgcgccaacctggcagggagtttcagctgtacctgccacgagggctat
agtggctcttcctgtgatcaggacatcgatgactgtgaccccaacccctgcctgaatggt
ggctcatgtcaggatggagtgggctccttttcctgctcctgcctacctggctttgctggc
ccccgctgcgcccgagatgtggatgagtgtctgagcagcccctgcggcccaggcacctgc
acagaccacgtggcctccttcacctgcacctgcccgccgggttatggaggcttcctctgc
gagcaggacctacctgactgcagccccagctcctgcttcaatggtgggacctgcgtggat
ggtgtgaactcgttcagctgcctgtgccgcctgggctacactggcacacactgccaacac
gaggccgacccttgcctctcgcgaccctgcttgcacgggggcatctgcgctgccgcccac
cccggcttccgctgtgcctgccctgaaggcttcaccggcgcgcagtgccagaccctggta
gactggtgcagccgcacaccttgtcagaatgggggccactgtgcccggaccggggcctct
ttctactgcctttgcccttcgggatggagcggccgcctctgtgacatccagagtctaccc
tgcagagaggctgcagcccaaatcggggtgcctctggagcagctgtgtcaggctggtggg
cagtgcgtggacaaggacagctcccactactgcgtgtgcccagagggccacacaggcagt
cactgtgagcgggaggtggacccctgcttggcccagccctgccagcatgggggcacctgc
cgaggctacatgggaggttatgtgtgcgagtgtccagctggctacactagtgacaactgt
gaggatgacatggacgagtgtgcctcccagccctgccagcatgggggcgtctgcattgac
cttgtggcccgctatctctgctcgtgtcctccaggaacgctgggcgtgctctgcgagatt
aatgaggatgactgtggcccaggcccagccctggacccgggcccccggtgcctgcacaat
ggtacctgtgtggacctggtgggtggcttccgctgcacctgccccccgggatacaccggc
ctgcgctgtgaggcggacatcaatgagtgtcgtccaggtgcctgccatgcggcacatacc
cgggactgcttgcaggacccaggtgggggcttccactgcctttgtcatgccggcttcaca
ggtccccactgtcagactgtcttgtctccctgtgagtcgcagccatgccagcatggaggc
cagtgccatcccagccccggcgctgggggagctctgactttctcttgccactgtgtcccg
ccgttctccggcccgcgctgcgagcgggtggcacgttcctgctgggagttgcagtgcccg
gtgggcgtcccgtgccagcagacggtccgtggaccgcgctgcgcctgtcccccggggctg
tcgggtcccgcctgccggggttcccgggggtcgccactgggagccgccaatgccagctgc
gtgacctccccctgcctccacgggggctcctgccgcccggagacgctggcgcccttcttc
cgctgcgcgtgcgcgtcaggctgggctgggccgcgctgtgagatacctgcagcggtgccc
gaggcccccgaggagccgtcttgcccgagagccgcctgcgaggccaaaagcggcgacaag
cgctgtgaccgagagtgcaacagcccaggctgcggctgggatggcggcgactgctcgctg
agcgtgagcgacccctggcggcagtgtgcggcgttgcagtgctggctcctcttcaacaac
agccgctgcgaccccgcctgcagctcgcccgcctgcctctatgacaacttcgactgccgc
gcaggcggccgggagcgcaactgcaacccggtgtatgagaagtactgcgcggaccacttt
gccgacggccgctgcgaccagggctgcaacacagaggagtgcggttgggatggactggac
tgtgcgggtgaggtgccagctctgctggcccgaggtgtcctggtgctcactgtgctgctg
ccgccggaggagctgctgcgctccagtgccgacttcctgcagcggctcagtggcatcctg
cgcacctctctgcgcttccgtctggatgagaacggccaggctatggtcttcccttaccac
cggcctggtcctggctccgaatcccggaatcggcgggagctggcccctgaggtgatcggc
tctgtggtgatgctggagattgacaaccgtctgtgcctgcagtcacctgagaatgaccac
tgttttcccgacgcccagagtgcggcagactatctgggagcgttgtcagcggtggagcgc
cttgacttcccgtacccactgcgggcagcacggggggaaccgctggagctgccagaacca
agcgtgccgctactgcccctgctggctgcgagtgccgtcttcctgctggtcattctcgtc
ctgggcgtcatggtggcccgccgcaagcgtgagcacagcaccctctggttccccgagggc
ttcgcgctgcacaaggatgctgcagctggccacaagggccggcgggaacccgtgggccaa
gatgctctgggcatgaagaacatggccaagggtgagagtctgatgggggaggtggccaca
gactggatggacacagagtgcccggaggccaagcgactgaaggtagaggagcccggtgtg
ggagctgaggatgctgtggactgccgccagtggacccagcaccacctggtggctgccgac
atccgtgtggcgccagccacggcgttgacgccaccacagggcgatgcagatgctgatggc
atggacgtcaacgtgcgcggtccagaaaggccctgtgcccacctcccttgtgacacactc
ctggtccctgcagatggcttcaccccgctaatgctggcctccttctgcgggggggccctg
gaagcaatcccagctgaggaggacgaggcagaagacacgtcagccagcatcatctcagac
cttatctgccagggggcacagcttggggctcggaccgaccgcacgggtgagacggccctg
cacctggctgcccgctatgcccgggctgatgcggccaagaggctgctggatgctggggca
gacaccaatgcccaggaccactcaggccgcacccccctgcacacagccgtcactgctgat
gcccagggtgttttccagattctcatccggaaccgctccacagacctggatgcccgcatg
gcagacggctccacagcactgatcctggcggcccgcctggcagtggagggcatggtggaa
gagctcattgccagccatgctgatgtcaatgctgtggatgaactcggaaaatcagcgtta
cactgggctgcagctgtcaacaacgtggaggccaccttggccctgctcaaaaatggagct
aacaaagacatgcaagatagcaaggaggagactccgctgttcctggccgccagggagggc
agctttgaggctgccaagctgctgctggaccactttgccaaccgtgagatcacagaccac
ctggacaggctgccccgggatgtggcccaggagcggctgcaccaggacatcgtgcgcttg
ctagaccagcccagtgggccccgtagcccccctggcccccacggcctggggcccttgctc
tgcccgcccggggccttcctcccaggcctcaaggtggcacagtccgggggcaagaagagc
cggaggcctcctgggaaggcggggctggggcctcagggcacccgggggcggggcaagaag
ctgaccctggcctgcccggggcccttggccgagagctcggtcacgctctcgccggtggac
tcgctggactccccacggccctttggtggcccccccgcgtcccctggcggcttccccctc
gaggggccctacgcggctgccacggccacagccgtgtctctggcacagcttggtggcgcg
ggccgggcaggtctcgggcgccagccccccgggggctgtgtgctcagcctgggcctgctg
aaccccgtggccgtccccctcgactgggcccggctgcccccacctgcccccccaggtccc
tctttcctgctgccgctggccccgggaccccagctgctgaaccccgggaaccccgtgtcc
ccccaggagcggcccccaccgtacctggcagccccaggacatggcgatgagttccccgcg
gccggggcccacagcagccccccaaaggcccgcttcctgcgggtccccagcgagcaccct
tacctgaccccatccccagagtcccccgagcactgggccagcccctcacctccctcactc
tcggactggtccgactccacgcccagcccggccactgccaccggggccacggccgctggg
acactgtctgcccagccgctccccctgtcggtccctggccctcttgctcagtcccagacc
cagctagggtcccagcctgaagtcacccccaagaggcaagtgttggcctga

KEGG   Delphinapterus leucas (beluga whale): 111170944
Entry
111170944         CDS       T05885                                 

Gene name
NOTCH4
Definition
(RefSeq) neurogenic locus notch homolog protein 4 isoform X1
  KO
K20996  Notch 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04330  Notch signaling pathway
dle04919  Thyroid hormone signaling pathway
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111170944 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111170944 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170944 (NOTCH4)
   05206 MicroRNAs in cancer
    111170944 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    111170944 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111170944 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111170944 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank_5 Notch Ank Ank_3 Ank_4 EGF_2 NODP NOD cEGF EGF_3
Other DBs
NCBI-GeneID: 111170944
NCBI-ProteinID: XP_022422280
UniProt: A0A2Y9MJU1
LinkDB
Position
Unknown
AA seq 1993 aa
MQPPSLLLPLLLLLLCRSVVQTRGLQCGSFPERCANGGTCLSLSQGQGTCQCAPGFLGET
CQFPDPCQDAQLCQNGGSCQALLPTLPSSPSPPSPLAPSFFCTCPSGFTGERCQAQLKDP
CSSFCSKMGRCHVQASGRPQCSCMPGWTGEHCQLRDFCSANPCVNGGVCLATYPQIQCRC
PPGFEGHACERDVNECFLDPGPCPKGTSCHNTLGSFQCLCPAGWGGPRCELRPGPCPPRG
CPNGGTCQVVPGRDSTFHLCLCPPGFTGPSCEVNPDDCVGHQCQNGGTCQDGLGTYTCLC
PEAWTGWDCSEDVDECEVQGPPRCRNGGTCQNSAGGFHCVCVSGWGGTGCEENLDDCVAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHREAQCNTNPLRGSTFCVCQP
GYTGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFDCLCPPGYTGSRCEADHNECLSQ
PCHPGSTCLDLLATFQCLCPPGLEGRLCEVETDECASAPCLNQADCHDLLNGFRCICRPG
FTGPRCEEDINECRSSPCANGGQCQDQPGSFHCKCLPGFEGPRCQAEVDECLRGPCPTGA
SCLDLPGAFLCLCPSGFTGHLCEIPLCAPNLCQPKQRCQDPEEEAHCLCPSGSPGCAPAE
DNCTCHHGHCQRSSCVCDVGWTGPECDTELGDCVSTPCAHGGTCHPQPFGFNCTCPTGYT
GPTCSEEVTACHSGPCLNGGSCSPSPGGYSCTCPLSHTGLRCQTSIDHCASAPCLNGGTC
VNRPSTYSCLCTTGFQGPRCEGRIRPSCADSPCRNRATCQDSPQGPRCLCPPGYTGGSCQ
TLIDSCAQKPCPHNSHCLQTGPSFQCLCLQGWTGPLCDLPLSSCQKAALSQGTEVSSLCQ
NGGICIDSGPSHFCHCPPGFQGSICQERVNPCESRPCQHGATCMAQPNGYICQCTPGYSG
QNCSKEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVELDPCQSQPCSHGGSCEATAGPPPGFTCHCPQGFEGP
TCSHRAPSCGLHHCHHGGLCLPSHKPGFPPRCACLNGYGGPDCLTPPVPPGCGPPSPCLH
NGSCSETPGLGGPGFRCSCPPSSPGPRCQRPGAKGCEGRSGDGACDAGCSGPGGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCRDH
FHNGHCEKGCNTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPSTLDRQLLALARVLSLT
LRVGLWVRKDSDGRNMVYPYPGAQAEEELGGAPDPSHHERATPQTQPTGKETDSLSTGFV
VVMDVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTEPPA
NQLPWPVLCSPVAGVLLLALGALLVLQLIRRKRREHGALWLPPGFTRRSQTQPVPRRRRP
PLGEDSIGLKALKPEAEVDEDGVVMCSGPKEGEEADQAEEMASPSKCQLWPLSSDCQELP
QAAMLTPPQDSEMDVPDVDTRGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLGG
GACPQVHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREV
CQLLLRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAA
AVNNARAARSLLQAGADKDALDGREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLA
PGDIARQRNHWDLLTLLEGAGPPEARHKATPGRGAGALQRARTASGSVPPRGGGAQPRCR
TLSAGAYPQARTLSVDLAAHGGGAYSHCRSLSKGAGEGPPLRGRRFSAGMRGPPSNLAIV
RGRSGVAAGSGGVASAVDWPCDWVALGACGPTSNTPVPPPCLTPSPERGSPQVAWGPPAH
QVITLNAGGEGEK
NT seq 5982 nt   +upstreamnt  +downstreamnt
atgcagcccccttcattgctgctgccgctgctgctgctgctgctgtgtcggtcagtcgtc
cagaccagagggctgcagtgcgggagtttcccagaacgctgtgccaacggaggcacctgt
ctgagcctatctcaggggcaagggacgtgccagtgtgcccctggcttcctgggtgagaca
tgccagtttccggacccctgccaggatgcccagctctgccagaatggaggcagctgtcaa
gccctgcttcccacccttcccagctcccccagccctccctctcccttggcccccagcttc
ttctgcacctgcccctctggcttcactggtgagaggtgccaggcccagctcaaggacccc
tgttcttccttctgttccaaaatgggccgctgccacgtccaggcctcgggccgcccacag
tgctcctgcatgccgggatggacaggtgagcactgccagctccgggacttctgctcagcc
aacccctgcgtcaacggaggggtgtgtctggccacatacccccagatccagtgccgctgc
ccacctggcttcgagggccatgcctgcgaacgcgatgtcaacgagtgtttcctggaccca
ggaccctgccccaagggcacctcctgccataacaccctggggtccttccagtgcctctgc
cccgctgggtgggggggtccacgctgtgagctccggccaggaccctgccctcccaggggc
tgtcccaatgggggcacctgtcaagtggttccagggagagactccaccttccacctctgc
ctgtgtcccccaggtttcacaggcccaagctgtgaggtgaatccagatgactgtgtcggg
caccagtgtcagaacgggggcacctgtcaggatgggctgggcacctacacctgcctctgc
ccagaggcctggacaggctgggattgctctgaagatgtggacgaatgtgaggttcagggt
ccccctcgctgcagaaacgggggtacctgccagaactcagctggtggcttccattgtgtg
tgtgtgagcggctgggggggcacgggctgcgaggagaacctggacgactgtgttgccgcc
acctgtgccccaggttccacctgcatcgaccgtgtgggctccttctcctgcctctgtcca
cctggccgcacaggcctcctgtgccacatggaggacatgtgtctgagccagccgtgccat
cgggaagcccagtgcaacaccaaccccctgaggggctccacattctgcgtgtgtcagcct
ggctacacggggcccacttgccaccaggatctggacgagtgtcagatggcccagcaaggc
cccagtccctgtgaacacggcggctcctgcctcaacacgcccggctcctttgactgcctc
tgtccccctggctacacgggatcccgctgcgaggccgatcacaatgagtgcctgtcgcag
ccctgccaccctggcagcacctgcctggacttgctcgccaccttccagtgcctctgccca
ccaggcttagaagggcggctctgtgaggtagagacagacgagtgcgcctctgccccttgc
ctgaaccaggctgactgccacgacctgctcaatggcttccggtgcatctgccggcccgga
ttcactggcccccggtgtgaggaggacatcaacgagtgcagaagctctccctgcgccaac
ggtgggcagtgccaggaccagcctggatccttccattgcaagtgtctcccaggctttgaa
ggcccacgctgtcaggcggaggtggacgagtgtttgagaggcccatgccccactggagcc
agctgccttgacctcccaggagctttcctttgcctctgcccatctggctttacaggtcat
ctctgtgaaattcccctgtgtgcccccaacctgtgccagcccaagcaaagatgccaggat
ccggaggaagaggcccactgcctctgccccagtggaagccctggctgtgccccagctgaa
gacaactgcacctgccaccatgggcactgccagagatcctcgtgtgtgtgtgatgtgggt
tggacaggaccagagtgtgacacagagctgggggattgcgtctccacaccctgtgcccac
ggagggacctgccacccccaaccctttggcttcaactgcacctgccccacaggttacaca
gggcccacttgcagcgaggaggtgacagcttgtcactcagggccctgtctcaacggtggt
tcctgtagccccagccctgggggctactcctgcacctgccctctgagccacaccgggctc
cgctgccagaccagcattgaccactgtgcctctgcaccgtgcctcaatgggggcacctgt
gtgaacaggcccagcacctactcctgcctctgcaccacgggcttccagggcccacgctgc
gagggaaggatccgtcccagctgtgcggacagcccctgtaggaacagggcaacctgccaa
gacagccctcagggtccccgctgcctctgtccccctggctacacaggaggcagctgccag
acgctgatcgactcatgcgctcagaagccctgtccacacaattcccactgcctccagact
gggccctccttccagtgcctgtgcctccagggatggactgggcctctctgcgacctaccg
ctgtcctcctgccagaaggctgctctgagccaaggcacagaagtctcttccctgtgccag
aatggaggcatctgcattgacagcggcccctcccatttctgccactgtccccctggattc
caaggcagtatatgccaggagagggtgaacccctgtgagtccaggccctgccagcacggg
gccacctgcatggcccaacctaatggttatatctgccagtgtacaccaggctacagtgga
cagaactgctcaaaggaacctgacgcttgtcaatcccagccctgtcacaaccatggaacg
tgcacccccaaacctggaggcttccactgtgcctgccctccaggctttgtggggctgcgc
tgtgagggggacgtggatgaatgtctggaccagccctgtcaccccacaggcactgcagcc
tgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggccagtgg
tgtgaagtggagctagacccctgccagagccagccctgctcccacggagggtcctgtgag
gccacagcaggaccacccccaggattcacctgccactgcccccagggttttgaaggcccc
acctgcagccacagagccccctcctgcggtctccatcactgccaccacggtggcctgtgt
ctgccctcccacaagcctggattcccaccccgctgtgcctgcctcaatggctatgggggc
cctgactgcctgaccccacccgtccctccaggctgtggccctccttctccatgcctacac
aatggcagctgctcagagacccctgggctggggggcccaggctttcgatgctcctgccct
cccagctctccagggccccggtgtcagaggcctggagcaaagggatgtgagggcagaagt
ggagatggggcctgcgacgctggctgcagcggcccaggaggaaattgggatggtggggac
tgctccctgggggtcccagacccctggaagggctgcccctcccattctcggtgctggctt
ctcttccgggatgggcagtgccatccacagtgtgactctgaagagtgtttgtttgatggc
tatgactgtgagactcctccagcctgcactccagcctatgaccagtactgccgtgatcac
ttccacaatggacactgtgagaagggctgcaacactgcagaatgtggctgggatgggggc
gactgcaggcccgaagacggggattcggagtgggggccctccctggccctgctggtggtg
ctgagcccctcaaccctggaccggcagctgcttgccctggcccgggtgctgtccctgact
ctgagggtagggctttgggtaaggaaagatagtgatggcaggaacatggtgtacccctat
cctggagcccaggccgaagaggagctaggaggagccccagacccctctcaccatgagaga
gcaacccctcaaacacagcctacaggcaaggagacggactccctcagcactgggtttgtg
gtggtgatggatgtggacttgtcccgctgtggccccgaccatcctgcatcccgctgtccc
tgggaccctgggctcctgctccgcttccttgctgcgatggccgcagtgggggccctggag
cccctactgccaggacccctgctggctgcccaccctcgtgcaggcaccgagccccccgcc
aaccagcttccctggcctgtactgtgctcgccggtggccggggtgcttctcctggccctc
ggggctcttctcgtcctccagctcatccgccggaagcgccgagaacatggggccctctgg
ctgccccctgggttcactcgaaggtctcagactcagccagttccccgccgacgccggccc
ccgctgggcgaggacagcatcggcctcaaggcactgaaaccagaggcagaagttgatgag
gatggagttgtgatgtgctcaggccccaaggaaggagaagaggcggaccaggctgaagaa
atggcctcaccctccaagtgccagctctggcctctgagtagtgactgtcaggaactcccc
caggcagccatgctgactcctccccaggattctgagatggatgtccctgatgtggacacc
cgtggacctgatggggtgacacccctgatgtcagcagtctgctgtgggggagtggagtcc
aggacctatcaggagacatggttgggaagccctgagccctgggaacctctgctgggtgga
ggggcctgtccccaggttcacaccgtgggcactggggagactcccctgcacctggctgct
cgattctcccggccaaccgctgcccgccgcctccttgaggcaggagccaaccccaaccag
ccagaccgggcagggcgcaccccgcttcacaccgctgtggctgctgatgctcgggaggtt
tgccagctcttactccgcagcagacagactgcagtagatgcgcggacagaggatgggacc
acagccctgatgctggccgccaggctagctgttgaggacctggttgaagaactgattgca
gcccaagcagatgtgggggccagagataaatggggaaaaaccgcgctgcactgggccgcc
gccgtgaacaacgcccgggccgcccgctcccttctccaggccggagccgataaagacgca
ctggacggcagggagcagacgccgctgttcctggcggcccgagaaggagccatggaggta
gcccagctgttgctggggctgggagccgcccgagggctgcgggaccaagccgggctagcg
cccggggacatcgcacgccagcgcaaccactgggatctgctgacgctgctggaaggggcg
ggaccaccggaggctcgtcacaaagcgacgccgggccgcggcgccggcgccttgcagcgc
gcgcggactgcatcaggaagcgtgcccccgcgtgggggcggggctcagccgcgctgccgg
acgctgtcagccggagcctatcctcaagcccggactttgtccgtagacttggccgcccat
gggggcggggcctattcgcactgccgaagcctatcgaaaggagcaggagaaggcccgccc
ctccgcggccgtaggttttctgcaggcatgcgcgggcctccgtccaaccttgcaatagtg
cgaggaagatccggggtcgcggccgggagcgggggtgtggcctcagctgttgactggccc
tgcgattgggtggctctaggagcctgcggccccacctccaacactccagtcccgcctcct
tgcctcactccgtcccctgagcggggatcccctcaagttgcatggggtcccccagcccac
caagtaataaccttaaatgcgggaggcgagggtgagaaataa

KEGG   Delphinapterus leucas (beluga whale): 111177023
Entry
111177023         CDS       T05885                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04330  Notch signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04919  Thyroid hormone signaling pathway
dle05020  Prion disease
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111177023 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111177023 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111177023 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177023 (NOTCH1)
   05206 MicroRNAs in cancer
    111177023 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    111177023 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    111177023 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111177023 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111177023 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank Ank_2 NODP NOD DUF3454 Ank_5 Ank_4 Ank_3 EGF_3
Other DBs
NCBI-GeneID: 111177023
NCBI-ProteinID: XP_022433868
UniProt: A0A2Y9NWE7
LinkDB
Position
Unknown
AA seq 2521 aa
MPPLLAPLLCLALLPALAARGLRCSQPSETCLNGGKCEVFPNGTEACVCSGAFAGQRCQA
PNPCLSAPCKNGGTCHTVERDGLVDYTCRCRLGLSGPLCLTPRDHACLASPCLNGGTCDL
LTLTEYKCLCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICGCPPGFHGPTCRQDV
NECSQNPGLCHHGGTCHNEVGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
AHECACLPGFTGQNCEANIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQHCTEDVDEC
QLMPNACQNGGTCHNAHGGYNCVCVNGWTGEDCGENIDDCASASCFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACSQDVDECSLG
ANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGYEGVHCEVNTDECASSPCLQNGRCLDKINEFVCECPTGFTGHLCQYDVDECASTPCRN
GAKCLDGPNTYTCVCTEGYTGPHCEVDIDECDPDPCHYGSCKDGVATFTCLCWPGYTGHH
CETNINECHSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASNPCDSGTCLDKI
DGYECVCEPGYTGSVCHINIDECADNPCHNGGTCEDGVNGFTCRCPEGYHDPTCLSEVNE
CSSNPCIHGACRDSLNGYKCDCDPGWSGANCDINNDECESNPCVNGGTCRDMTSGYVCAC
REGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYAGATCEVVLAPCAPGPCR
NGGECKESKDYESFSCACPVGWQGQTCEIDINECVKSPCRAGASCQNTNGGYRCHCQAGY
TGRNCETDVDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCRNGAN
CTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCHDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGRCWQTNA
LYRCECHSGWTGLYCDVPSVSCEVAAWQQGINVTHLCRNGGLCMNVGNTHHCHCQAGYTG
SYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEVNECLSQPCRNGGTCI
DLTNTYKCSCPRGTQGVHCEINVDDCNPPIDPVSRGPRCFNNGTCVDQVGGYSCTCPPGF
VGERCEGDVNECLSNPCDARGTQNCVQRVNAFHCECRAGHTGRRCESVINGCKDRPCKNG
GSCAVASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCISGPRSPTCLCLGPFT
GPECQFPVGSPCMGGNPCYNQGSCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGVGLD
IPPPQIAEACELPGCREEAGNKVCSLQCNNHACGWDGGDCSLNFNDPWQNCTESLQCWKY
FSNGRCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGL
DCAEHVPERLAAGTLVLVVLMPPEQLRNHSLHFLRELSRLLHTNVVFRRDAGGQQMIFPY
YGREGELRKHPIRRSVEGGASRPAGGGGGRRRRELDPMDIRGSIVYLEIDNRQCVQSSSQ
CFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAPLHFMYVAVVAFVLLFFVG
CGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALVDDNQS
EWGDEGLEAKKFRFEEPVVLPDLDGQTDRRQWTQQHLDAADLRASATAPTPPQGEADTDC
MDVNVRGPDGFTPLMIASCSGGGLETGKSEEEEDAPAVISDFIYQGASLHSQTDRTGETA
LHLAARYSRSDAAKRLLEAGADANIQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDAR
MHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVEAAVVLLKNG
ANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVR
LLDEYSLVRSPPLHGAPTLSPPLCSPSGYLGNLKPAVQGKKARKPSTKGLACGGKEPKDL
RARRKKSQDGRGCLLDSSSALSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLNHLPG
MPEAHLGVSHLSVAAKPEMAALSGGGRLAFEAGPPRLSHLPVASGTSTVLGAGGSGSCGG
AVNFTVGGAAGLNGQCEWLSRLQNGLVPNQYNPLRGSVAPGTLSTQAPALQHGMVGPLHG
GLSATALSQMMSYQALPNTRLAAQPHLVQHQQNLQMQPQAPQPHLGVGSATSGHVARSFL
AGELSQADVQPLGPGSLAAHTVLPQDSQVLPTSLPAALAPPMTTAQFLTPPSQHSYSSPV
DNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMPSQIAHVPEAF
K
NT seq 7566 nt   +upstreamnt  +downstreamnt
atgccgcctctcctggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggcctgcgatgttcccagcccagcgagacctgcttgaatggcgggaagtgtgaagtgttc
cccaacggcaccgaggcctgtgtctgcagcggagcctttgcgggccagcgatgccaggcg
cccaacccctgcctcagcgccccctgcaagaatggcgggacgtgccacacggtggagcgc
gacggccttgtggactacacctgccgctgccgcctgggcctctcggggccgctgtgcctg
acgccccgcgaccatgcctgcctcgccagcccctgcctcaacggcggcacctgcgacttg
ctgactctcaccgagtacaagtgcctctgccccccgggctggtcagggaagacatgccag
caggcggacccctgcgcctccaacccctgtgccaacgggggccagtgcctgcccttcgag
gcctcgtacatctgcggctgcccacccggcttccacggccccacctgcaggcaggacgtc
aacgagtgcagccagaaccccgggctctgccaccacggtggcacctgccacaatgaggtc
ggctcctaccgctgcgcctgccgcgccacccacaccggcccccactgcgagctgccctat
gtgccctgcagcccctccccctgccagaacgggggcacctgccgccccacgggggacacc
gcccacgaatgcgcctgcctgccaggcttcaccggccagaactgcgaggcaaacattgac
gactgtccaggaaacaactgcaagaacggaggcgcctgcgtggacggcgtgaacacttac
aactgccgctgccccccggagtggacaggtcagcattgcaccgaggatgtggacgagtgc
cagctcatgcctaacgcctgccagaacggcgggacctgccacaatgcccacggcggctac
aactgcgtgtgcgtcaacggctggacaggcgaggactgcggtgagaacattgatgactgc
gccagtgcctcctgcttccacggtgccacctgccacgaccgcgtggcctccttctactgc
gagtgtccccacggccgcacgggcctgctgtgccacctcaatgacgcctgcatcagcaac
ccctgcaatgagggctccaactgcgacaccaaccccgtcaacggcaaggccatctgcacc
tgccccccgggctacacgggcccggcctgcagccaggacgtggacgagtgctcgctgggc
gccaacccctgtgagcacgcgggcaagtgcatcaacacgctgggctccttcgagtgccag
tgtctgcagggctacaccggcccgcgctgcgagatcgacgtcaacgagtgtgtgtcgaac
ccgtgtcagaacgacgccacctgcctggaccagatcggggagttccagtgcatctgcatg
cccggctacgagggcgtgcactgcgaggtgaacacggacgagtgtgctagcagcccctgc
ctccagaacggccgctgcctagacaagatcaacgagttcgtgtgcgagtgtcccacaggc
ttcaccgggcacctgtgccagtacgacgtggacgagtgtgcaagcacgccctgcaggaat
ggcgccaagtgcctggacgggcccaacacctacacctgcgtgtgcacagaaggctacaca
gggccccactgtgaggtggacattgacgagtgcgaccccgacccctgtcactacgggtcc
tgcaaggacggcgttgccaccttcacctgcctgtgctggccgggctacacgggccaccac
tgcgagaccaacatcaacgaatgccacagccagccctgccgccacgggggcacctgccag
gaccgcgacaatgcctacctctgcttctgcctcaaggggaccacaggccccaactgtgag
atcaacctggacgactgtgccagcaacccctgtgactcgggcacatgtctggataagatt
gacggctacgagtgtgtatgtgagccgggctacacagggagcgtgtgccacatcaacatc
gatgagtgcgcggacaacccctgtcacaacggcggcacctgcgaggacggcgtcaacggc
ttcacctgccgctgccccgagggctaccacgaccccacctgcctgtccgaggtcaacgag
tgcagcagcaacccctgcatccatggggcctgccgggacagcctcaacgggtacaagtgt
gactgtgaccccgggtggagcggggcgaactgtgacatcaacaacgacgagtgtgagtcg
aacccctgtgtcaacggcggcacctgcagggacatgaccagcggctacgtgtgtgcgtgc
cgggaaggcttcagtggccccaactgccagaccaacatcaacgagtgtgcgtctaacccg
tgtctgaaccagggcacgtgtatcgacgacgtggctgggtacaagtgcaactgcctcctg
ccctacgcaggagccacgtgcgaggtggtgctggcgccatgtgcccccggcccctgcaga
aacggcggcgagtgcaaggagtccaaggactacgagagcttctcctgcgcctgccccgtg
ggctggcaggggcagacctgcgagattgacatcaacgagtgcgtgaagagcccgtgccgc
gcaggagcctcctgccagaacaccaacggcggctaccgctgccactgccaggccggctac
acgggccgcaactgcgagacggacgtcgatgactgccggcccaacccgtgccacaacggg
ggctcctgcacagacggcatcaacacggccttctgcgactgcctgcccggcttccagggc
gccttctgcgaggaggacatcaacgagtgcgccagcaacccctgccgcaatggcgccaac
tgcaccgactgcgtggacagctacacctgcacctgccctgcgggcttcagtgggatccac
tgtgagaacaacacgcctgactgcacggagagctcctgcttcaacggcggtacctgcgtg
gacggcatcaactcctttacctgcctgtgtccgccaggcttcacgggcagctactgtcag
cacgacgtcaatgagtgcgactcgcggccctgcctgcacggcggcacctgccacgacagc
tacggcacctacaagtgcacctgcccgcagggctacactggcctcaactgccagaacctc
gtgcgctggtgtgactcctcgccctgcaagaatggcggcaggtgctggcagaccaacgcc
ttgtaccgctgcgagtgccacagtggctggactggcctctactgcgacgtgcccagcgtc
tcctgtgaggtggccgcatggcagcaaggcatcaatgttacccacctgtgccggaacgga
gggctctgcatgaacgtgggcaacacgcaccactgccactgccaagcgggctacacgggc
agctactgtgaggaccaggtagacgagtgctcgcccagcccttgccagaacggggccact
tgcaccgactaccctggtggctactcctgcgagtgcgtggctggctaccacggggtgaac
tgctccgaggaggtcaacgagtgtctgtcccagccgtgccggaatgggggcacctgcatc
gacctcaccaacacctacaaatgctcctgcccccggggcacgcagggcgtgcactgcgag
atcaacgtggacgactgcaacccccccatcgatcccgtgtcccggggccccaggtgcttt
aacaacggcacctgcgtggaccaggtgggcggctacagctgcacctgcccgcccggcttc
gtgggcgagcgctgtgagggtgatgtcaacgagtgcctgtccaacccctgcgacgcccgc
ggcacccagaactgcgtgcagcgcgtcaacgccttccattgcgagtgccgcgccggccac
accgggcgccgctgtgagtcggtcatcaacggctgcaaggacaggccctgcaagaacggg
ggcagctgtgccgtggcctccaacaccgcccgcgggttcatctgcaaatgcccagcgggc
ttcgagggtgccacgtgtgagaacgacgcacgcagctgcggcagcctgcggtgcctcaac
ggcggcacctgcatctcgggcccgcgcagccccacctgcctgtgcctaggccccttcacc
ggccctgagtgccagttccctgtcggcagcccctgcatgggtggcaacccctgctacaac
cagggcagctgcgagcccacgtccgagagccccttctaccgctgcctgtgccccgccaag
ttcaacgggctcctgtgccacatcctggactacagcttcggcggcggcgtgggcctcgac
atccccccgccgcagatcgcggaggcctgcgagctccccggctgccgcgaggaggccggc
aacaaggtctgcagccttcagtgcaacaaccacgcctgcggctgggacggcggcgactgc
tccctcaacttcaacgacccctggcagaactgcactgagtccctgcagtgctggaagtac
ttcagcaacggccgctgcgacagccagtgcaactcggccggctgcctcttcgacggcttc
gactgccagcgcgcagaaggccagtgcaaccccctgtacgaccagtactgcaaggaccac
ttcagggacgggcactgcgaccagggctgcaacagcgccgagtgcgagtgggacgggctg
gactgcgcggagcacgtgcccgagcggctggcggccggcacgctggtgctggtggtgctg
atgccgcccgagcagctgcgcaaccactcgctgcacttcctgcgcgagctcagccgcctg
ctgcacacgaacgtggtcttcaggcgcgacgccggcggccagcagatgatcttcccctac
tacggccgcgagggggagctgcgcaagcaccccatcagacgctctgtggagggcggggcc
tcgcggcccgcgggcggcgggggcgggcgccggcgcagggagctggaccccatggacatc
cgcgggtccatcgtctacctggagatcgacaaccggcagtgcgtccagtcgtcctcacag
tgcttccagagcgccacggacgtggccgccttcctgggcgcgctcgcctcgctgggcagc
ctcaacatcccctacaagatcgaggccgtgcagagtgagacggtggagccgcccccgccc
gcgccgctgcacttcatgtacgtggccgtggtggccttcgtgctgctcttctttgtgggc
tgcggggtgctgctgtcgcggaagcgccggcggcagcatggccagctctggttccccgag
ggcttcaaggtgtcggaggccagcaagaagaagcggcgggagcccctcggcgaggactcc
gtgggcctcaagcccctgaagaacgcctcggacggcgccctcgtggacgacaaccagagc
gagtggggcgacgagggcctggaagccaagaagttccggttcgaggagcccgtggtcctt
cccgacctggacggccagacagaccgccggcaatggacccagcagcacctggacgctgct
gacctccgcgcgtccgccacggcccccacgccgccccagggcgaggctgacaccgactgc
atggacgtcaacgtccgtgggccggacggcttcacgcccctcatgatagcctcctgcagc
ggagggggcctggagaccggcaagagcgaggaggaggaggacgcacccgccgtcatctcg
gacttcatctaccagggcgccagcctgcacagccagacggaccgcaccggcgagaccgcc
ctgcacctggccgcccgctactcgcgctccgacgcggccaagcgcctgctggaggccggc
gctgacgccaacatccaagacaacatgggacgcaccccgctgcacgcggccgtggctgcc
gacgcgcagggtgtctttcagatcctcatccggaaccgagccacggacctggacgcccgc
atgcacgacggcacaactccactgatcctggccgcccgcctggccgtcgagggcatgctg
gaggacctcatcaactcccacgccgacgtcaacgccgtggacgacctgggcaagtccgcc
ctgcactgggccgccgcggtgaacaacgtggaggccgccgtcgtgctcctgaagaatggg
gccaacaaggacatgcagaacaacaaggaggagacgcctttgttcctggccgcccgggag
ggcagctacgagacggccaaggtgctgctggaccatttcgccaaccgggacatcacggac
cacatggaccgcctgccccgtgacatcgcgcaggagcgcatgcaccacgacatcgtgcgg
ctactggacgagtacagcctggtgcgcagccccccgctgcacggcgcgcccaccctgtcg
ccccctctctgctctcccagcggctacctgggcaacctcaagcctgccgtgcagggcaag
aaggcccgcaagcccagcaccaagggcctggcctgcggcggcaaggagcccaaggacctc
agggcgcggaggaagaagtcccaggacggcaggggctgcttgctggacagctcgagcgcg
ctgtcgcccgtggactccctggagtccccccacggctacctgtcggatgtggcctcccca
cccctcctgccctcccctttccagcagtctccctctatgcccctcaaccacctgcccggg
atgcccgaggcccacctgggcgtcagccacctgagcgtggcggccaagcccgagatggcg
gcgctgagtgggggtggccggctggccttcgaggcggggccaccacgcctctcccacctt
cccgtggcttccggcaccagcacggtcctgggtgccggtggcagcgggagctgcggtggg
gccgtgaatttcaccgtgggcggggccgcaggcttgaacggccagtgcgagtggctgtcc
cggctgcagaatggcctggtgccaaaccagtacaacccgctgcgagggagcgtggcgccg
ggcaccctgagcacgcaggcccccgccctccagcacggcatggtgggcccgctgcacggc
ggcctgtctgccaccgccctgtcccagatgatgagctaccaggccctgcccaacacgcgg
ctggccgcccagcctcacctggtgcagcaccagcagaacttacagatgcagccgcaggca
ccgcaaccgcacctcggcgtgggctcggccaccagcggccacgtggcccggagcttcctg
gcgggggagctgagccaggcggacgtgcagcccctgggccccggcagcctggcggcgcac
accgtcctgccgcaggacagccaggtcctgcccacatcgctgccggccgcgctggccccg
cccatgaccaccgcccagttcctgacgcccccctcccagcacagctactcctcccccgtg
gacaacacccccagccaccagctgcaggtgcccgagcaccccttcctcaccccgtccccg
gagtcccccgaccagtggtccagctcatcgccacactccaacatctccgactggtccgag
ggcatctccagcccgcccaccagcatgccgtcccagatcgcccacgttcctgaggccttt
aagtga

KEGG   Delphinapterus leucas (beluga whale): 111179961
Entry
111179961         CDS       T05885                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 isoform X1
  KO
K20994  Notch 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04330  Notch signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04919  Thyroid hormone signaling pathway
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    111179961 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111179961 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111179961 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179961 (NOTCH2)
   05206 MicroRNAs in cancer
    111179961 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    111179961 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111179961 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111179961 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 EGF_2 Notch NOD Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 111179961
NCBI-ProteinID: XP_022439643
UniProt: A0A2Y9PB45
LinkDB
Position
Unknown
AA seq 2471 aa
MPALRPAPLWALLALWLCRATPALALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGFIGEDCQYSTTHPCFGSHPCLNGGK
CHVLSRDTYECTCQVGFTGKLCQWTDTCLSQPCANGSTCTTVANQFSCTCLAGFTGQKCA
SDVNECDVPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFAFECNCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCGENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGGDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCVCNPGYM
GAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASSPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLSGYKCLCDAGWVGINCEVDRNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCLVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAGVCKEAPNFESYTCLCAPGWQGQRCTVDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDRCQTDMDECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCIDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
EKAQSRCLCPSGWAGAYCDVPNVSCEVAASHRGVPVDRLCQHSGICISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCAS
SPCQHGGSCYPQRQPPYYSCKCSPPFWGSHCEFYTAPTSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFEDNHCDQGCNSEECGWDGLDCAAGRPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDAQGDLMVYPYYGEKSAAMKKQRLTRRSLPGDQEREVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKRTQLIY
LLAVAVVIVLFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPNAKSVVPCSLPNLAKEAKDAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPVLATAAPPAPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHHHIVPPGSGSAGSLGRLHPVTVPADWMNRVEVNETQYNEMFGMVLAPAEGTHP
GITPQSRPPEGKHLPAPREPLPPIVTFQLIPKGSIAQPAGAAQPPSSCPPAVAGTLPTMY
QIPEMARLPSMAFPTAMMPQQEGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGAHMS
EPPRSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctccgctgtgggcgctgctggcactgtggctgtgccgcgcg
acccccgcgcttgcattgcaatgtcgggacggctatgagccctgtgtaaatgaaggaata
tgtgttacctaccacaatggtacagggtactgcaaatgcccagagggattcttgggagaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacgtgtgtg
gcccaggctatgttggggaaagccacatgccgatgtgccccgggcttcataggcgaggac
tgccagtactcgaccactcacccctgctttgggtctcacccttgcctgaatggaggcaag
tgccacgtgcttagccgggatacctatgagtgcacctgccaagtcggttttacaggtaaa
ctgtgccaatggactgatacctgtctgtctcagccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcacatgcctcgcaggcttcacagggcagaagtgtgca
agtgatgtcaatgagtgtgatgttccaggacaatgccagcacggtggcacctgcctcaac
ctcccgggttcctatcagtgccagtgcccccagggcttcacaggccagcactgtgacagt
ccctacgtgccctgtgcaccctccccctgtgtcaacggaggcacctgccggcagactggt
gacttcgcctttgagtgcaactgccttccaggttttgaaggggtcacctgtgagcggaat
attgatgactgtcctaatcacaagtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgcccccctcagtggacaggacagttctgcacagaggatgtggat
gagtgcctgctgcaacccaatgcctgtcagaacgggggcacctgtaccaaccgcaatggg
ggctatggctgtgtgtgtgttaatggctggagcggggatgactgcggtgagaacattgat
gactgcgccttcgcctcctgcactccgggctccacctgcattgatcgtgtggcctccttc
tcttgcatgtgcccagaaggaaaggcaggtctcttatgtcatctggatgatgcatgcatc
agcaacccctgccacaagggggcactgtgtgacaccaaccctctgaacggacagtatatt
tgcacctgtccacaaggctacaaagggggtgactgtacagaagatgtggatgagtgtgcc
atggccaatagcaatccttgtgagcatgcgggaaaatgtgtgaacacagatggtgccttc
cactgtgagtgtctgaagggctatgcagggcctcgttgcgagatggacatcaacgagtgc
cattcagacccctgcaagaatgatgccacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattggagataaatgaatgtcagagc
aacccttgcgtgaacaatggacagtgtgtggataaagtcaatcgcttccagtgtctgtgt
ccgcctggtttcactgggccagtttgccagatcgatattgacgactgttccagtactcca
tgtctgaatggggcaaagtgtatagatcacccaaatggttatgaatgccagtgcgccaca
ggattcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggccagtgtcaggatgggattgattcctacacctgcgtctgcaatccagggtacatg
ggcgccatctgcagcgaccagatagatgaatgttacagcagcccttgcttgaatgagggt
cgctgcatcgacctggtaaatggttaccagtgcaactgccagccaggcacatcaggtgtt
aattgtgaaatcaattttgatgactgtgcaagtagcccttgtgtccatggagtctgtatg
gatggcgttaatcgttatagctgcgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcgacatgtatcaacgat
gtgaacggtttccgctgtatatgccctgaggggccccatcatcccagctgctactcacag
gtgaacgagtgcctgagcaatccctgtgtccacggaaactgtactgggggcctcagtgga
tacaagtgcctctgtgatgcaggctgggttggcatcaactgtgaagtggacagaaatgaa
tgtctttctaatccatgccagaacggaggaacttgtgacaatctggtgaatggatacagg
tgcacttgcaagaagggctttaaaggctataactgtctggtgaatattgatgaatgtgct
tcgaatccatgtctgaaccaaggaacctgctttgatgatataagtggttatacctgccac
tgtgtactgccatacacaggaaagaactgtcagactgtattagctccctgttccccaaac
ccttgtgagaatgctggtgtttgcaaagaggcaccaaattttgagagttacacctgcctg
tgtgctcctggctggcaaggtcagcggtgtacagttgacattgacgagtgtgtctccaag
ccctgcatgaaccacggtctctgccataacacccagggcagctacatgtgcgagtgtcct
ccaggcttcagtggtatggactgtgaggaggacatcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtagacggagtgaatactttctcctgcctatgccttccgggc
ttcactggggacaggtgtcagacagacatggatgagtgtctgagtgaaccctgtaagaac
ggagggacctgctctgactatgtcaacagttacacctgcaagtgccaggcgggatttgat
ggagtccactgtgagaacaacattgacgagtgcactgagagctcctgtttcaacggtggc
acatgtatcgatgggattaactccttctcttgcttgtgccctgtgggcttcactggcccc
ttctgcctccatgagatcaatgaatgcaactctcatccatgcctgaatgaaggagtatgt
gttgatggcctgggtacctaccgctgcatctgcccattgggctacactgggaaaaactgt
cagaccctggtgaacctctgtagtcggtctccatgtaaaaacaaaggtacttgcattcag
gaaaaagcacagtcccggtgcctgtgtccgtctggatgggctggtgcttactgtgacgtg
cccaatgtctcctgtgaggttgcggcctcccacagaggggtgcccgttgaccgcctgtgc
cagcactcaggcatctgtatcagtgctggcaactcgcatcactgccagtgccccctgggc
tacaccgggagctactgtgaggatcagctggatgagtgctcgtccaatccttgccagcac
ggagccacctgcagggacttcattggtggatacagatgtgagtgtgtcccaggatatcag
ggtgtcaattgcgagtatgaagtggatgagtgccagaaccagccatgccagaatggaggc
acctgtatcgaccttgtgaaccatttcaagtgctcctgcccaccaggcactcggggcctg
ctttgtgaagagaacattgatgactgtgccaggggtccccactgccttaatggtggtcag
tgtgtggataggattgggggctacagttgtcgctgcttgcctggctttgctggagagcga
tgtgagggagacatcaacgagtgcctctccaacccctgcagctctgagggcagcctagac
tgcatacagcttaccaatgactacctgtgtgtctgccgcagtgcctttaccggtcgtcac
tgtgaaacgttcgtcgatgtgtgtccccagatgccttgcctgaacggagggacttgtgct
gtggccagcaacatgcctgatggtttcatttgtcgttgtcccccgggattctctggggcg
agatgccagagcagctgtggacaggtgaagtgtaggagaggggagcagtgtgtgcacaca
gcctcaggaccccgctgcttctgccccaacccccaggactgcgactcaggctgtgccagt
agcccctgccagcacgggggcagctgctaccctcagcgccagcctccttattactcttgc
aagtgttccccgccgttctggggcagccactgtgaattctacacagctcccaccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcgtctgcgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttccctcaccatggag
aacccctgggccaactgctcctccccgctcccctgctgggattacatcaacaaccagtgt
gatgagctgtgcaacacggctgagtgcctgtttgacaactttgaatgccagaggaatagc
aagacgtgcaaatacgacaaatactgtgcagaccacttcgaagacaaccattgtgaccag
gggtgcaacagtgaggagtgtggctgggatggcctggactgtgctgctggccggccagaa
aacctggcagagggcaccctggtaattgtggtgctgatgccgcctgaacagctgctccag
gatgctcgcagcttcttgcgtgcactgggcaccctgctccacaccaacctacgcatcaaa
cgggatgcccagggggacctcatggtctacccctattatggtgaaaagtcagctgccatg
aagaagcagagattgacgcgcaggtcccttccaggcgatcaagaacgggaagtggctggc
tctcaggtattcctggaaattgacaaccgccagtgtgtccaagactcagaccagtgcttc
aagaatacggatgcggcagcagctcttctggcgtctcacgccatccaggggaccctgtcg
taccctcttgtgtctgttgtcagtgaatccctgaccccaaaacgcacccagcttatctat
ctacttgctgttgctgttgttattgtcttgtttattatcctgctgggagtgatcatggca
aaacgaaagcgtaagcatggctccctctggctgcctgaaggcttcacccttcgccgtgac
tccagcaatcacaaacgtcgtgagccagtgggacaggatgctgtggggctgaaaaatctc
tcagtgcaagtctcagaggctaacctaattggttctggaacaagtgaacattgggtcgac
gatgaagggccccagccaaagaaagccaaggctgaagatgaggctttactctcagaagaa
gatgatcccatcgaccgacggccgtggacacagcagcaccttgaagctgcagatatccgt
aggacaccatcgttggctctcactcctccgcaggcagagcaggaggtggatgtgctggat
gtgaacgtccgcggcccagatgggtgcaccccactgatgctggcttctctccgaggaggc
agctcagatatgagtgatgaagatgaagatgcagaggactcttccgccaacatcatcaca
gacttggtctaccagggtgccagcctccaagcccagacagaccggactggtgagatggcc
ctgcatcttgcagcccgctactcgagggccgacgctgccaagcgcctcctggatgcaggt
gccgatgccaatgcccaggacaacatgggccgctgccctctccatgccgccgtggcagcc
gatgcccaaggtgtcttccagatactgatccgcaaccgagtaactgatctagatgccagg
atgaatgatggcacgacacccctgatcctggctgcccgcctagctgtggagggaatggtg
gcagagttgatcaactgccaagccgatgtgaatgcagtggacgaccacggaaaatctgct
cttcactgggcagctgctgtgaataatgtggaggcgacccttttgctgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacccctctgtttctcgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgggacatcacagac
cacatggatcgtcttccccgggacgtggcccgggaccgcatgcaccatgacattgtgcgc
ctgctggatgagtacaatgtgaccccgagccctccaggcaccgtgctgacctctgctctc
tcacctgtcatctgtggacccaacagatcttttctcagtctgaagcacaccccgatgggc
aagaagtccagacggcccaatgccaagagtgttgtgccctgtagcctccctaaccttgcc
aaggaggccaaggatgccaaggggagtaggaggaagaagtctctgagtgacaagggccag
ttgtctgagagctcagtgactctgtcccccgttgattccctagaatctcctcacacatat
gtttctgataccacatcctctccaatgattacatcccccggaatcttacaggcctcaccc
aaccctgtgttggccactgctgccccccctgccccagtccatgcacagcatgcactgtct
ttctctaaccttcatgagatgcagcccttggctcacggggccaacactgtgcttccctca
gtgagccagctgctgtcacaccaccacattgttcccccaggcagtggcagtgcggggagc
ttgggtaggctacatccagtcaccgtcccagcggactggatgaaccgtgtggaggtgaat
gagacccagtacaacgagatgttcgggatggtcctggctccagctgagggcactcaccct
ggcataactccccagagcaggccgcctgaagggaagcatttacctgcccctcgagagccc
ttgccccccatcgtgactttccagctaatccccaaaggcagcattgcccaaccagccggg
gctgcccagcctccatccagctgccctccagctgttgcaggcaccctgcccaccatgtat
cagattccagaaatggctcgtttgcccagtatggcttttcccactgccatgatgccccag
caggaagggcaggttgctcagaccattctcccagcctaccacccctttccagcctctgtg
ggcaagtatcccacacccccttcacagcatagctatgcttcctccaatgctgctgagaga
acgcccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagctcatccccccactctgcttctgactggtcagatgtgacc
accagccccactcctgggggtgctggaggaggtcagcggggacctggggcacacatgtct
gagccaccacgcagcaacatgcaggtctatgcatga

DBGET integrated database retrieval system