KEGG   Delphinapterus leucas (beluga whale): 111166590
Entry
111166590         CDS       T05885                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04062  Chemokine signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04217  Necroptosis
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05223  Non-small cell lung cancer
dle05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111166590 (JAK3)
   04151 PI3K-Akt signaling pathway
    111166590 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111166590 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111166590 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    111166590 (JAK3)
   04659 Th17 cell differentiation
    111166590 (JAK3)
   04062 Chemokine signaling pathway
    111166590 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166590 (JAK3)
   05203 Viral carcinogenesis
    111166590 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111166590 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    111166590 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166590 (JAK3)
   05161 Hepatitis B
    111166590 (JAK3)
   05162 Measles
    111166590 (JAK3)
   05169 Epstein-Barr virus infection
    111166590 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166590 (JAK3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111166590 (JAK3)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   111166590 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH Kdo SH2
Other DBs
NCBI-GeneID: 111166590
NCBI-ProteinID: XP_022414132
UniProt: A0A2Y9M4G7
LinkDB
Position
Unknown
AA seq 1104 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRLPMGLSLKEQGECLSLAVLDLAQMALEQGQR
PEELLKTISYKVCLPPGLRDMIQGLNFVTRRRIQRTVRRALRRLAACQADKHSLMAKYIM
DLERLDPDRATETFRVGLPGAAGGQDAPGQLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPRFGPAGEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSGHYFC
KEVAPPRLLEQVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVPTP
LGPDYKGCLIRCDPTGTFSLAGLGQPHSSLRELLAAYWGGGLHVDGVELNLTFCCTPRPK
EKSNLIVVRRDCNPPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVYLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGALAPHDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRLSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCERDVPALCRLLELLADGQRLPAPPACPGEVHELMKLCWAP
SPQDRPPFSTLGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacgcccctgatccctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcacgtgctgctgcccccgcggggccctggacccccacagtgc
ctatccttctcctttggggaccactcagctgaagagctatgtgtttgggctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggccttggaggacctgtcctgt
tggttccccccgagccacatcttctccgtggaggacacgggcacccaggtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgccaccgctttgggcta
cgaaaggacttagccagtgccatccttgacctgccagtcctggagcacctctttgcccag
caccgcaatgacctggtcagtggccgcctcccgatgggcctcagcctcaaggagcagggt
gagtgtctcagcttggctgtgctggacctggcccagatggccctcgagcagggtcagcgg
cccgaggagctgctgaagaccatcagctacaaggtctgcctgcccccgggcctgcgcgac
atgatccagggcctgaacttcgtgacgcggaggcgtatccaaaggacagtgcgccgggcc
ttgcgccgcttggccgcctgccaggctgataagcactcgctcatggccaagtacatcatg
gacctcgagcggctggacccagacagggccaccgagaccttccgcgtgggcctccccgga
gctgctggtggtcaggatgcgccggggcagctccgcgtggctggcggcagtggcatcgcc
tggagcccgggagaacacgaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggccccacgctttggccccgccggggagcaccgcctggtcaccatc
accaggacagacaaccagatcctggaggccgagttcccggggctgcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccactgactccgggcactacttctgc
aaggaggtggcgccgccgcggctgctggagcaggtggctgagcagtgccatggccccatc
accttggattttgccatcaacaaactcaagactgggggttcacttccaggctcctacgtt
ctccgccgcagtccccaggatttcgacagctacctcctaactgtctgtgtcccgaccccc
ctgggccctgattacaagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccagccccacagcagtcttcgagagctcctggcagcctattggggtggt
gggttgcacgtggatggggttgagctgaacctcaccttctgctgcacccccagacccaaa
gaaaagtccaatctgattgtggtccggagagattgcaacccacccacatcatcccctgtt
cagccccaatcccaatgccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggtcacgggtcctttaccaagatttaccggggctgtcgc
catgaggttgtggatggggaggcccgagagacagaggtgctgctcaaagtgatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcatccttgatgagccaagtgtcg
taccagcatctcgtgttgctccatggcgtgtgcatggctggagacagcataatggtgcag
gaatttgtatacctgggagcgctggacacgtatctgcgcaagtgtggccagctggtgccg
gccagctggaagctacaggtgatcaaacagctggcttatgccctcaactatctggaagac
aaaggtctccctcacggcaatgtctcagcccggaaggtgctcctggctcgggagggggct
gacgggaacctacctttcatcaagctgagtgaccccggtgtcagcccgactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgagtgtctccaggaggcccga
acacttggcttggaagctgacaagtggggatttggtgccacagtctgggaggtgttcagc
ggtgtcacaatgcccatcagcaccctggatcctgccaagaagctccagttttaccaggaa
cggcagcaactgcctgcacccaagtggatggagctggccctgctcatccaacagtgcatg
gcctacgagccaggccagaggccctctttccgcgctgtcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggtgccctggctccccatgat
gggctttggaatggcgcccagctctatgcctgccaggaccctaccatctttgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggaactgtgccgc
tatgacccgctgggcgacaacacaggtgccctggtggccgtgaagcagttgcagcacagc
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtcagctatggcccaggccgcctgagcctgcggctg
gtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcggcaccgcgcgcgc
cttgacgctggccgcctgctcctctacgcctcgcaaatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcagcccgtaacatcctggtggagagcgag
acgcatgtcaaaatcgcagacttcggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccgcgagccaggccagagccccatcttctggtacgccccagagtccctctcg
gacaacatcttctcgcgccagtcggatgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagagctgtagcccctcagccgagttcttgcggatgatgggatgt
gagagagatgtgccagccctctgccgcctcctggagctgctggccgacggccagaggctg
cccgcacctcctgcctgtcctggtgaggttcatgagctcatgaagctgtgctgggcccct
agcccacaagaccggccaccattcagcaccctgggcccccagctggatgcactgtggagt
ggaagccagggatag

DBGET integrated database retrieval system