KEGG   Delphinapterus leucas (beluga whale): 111166674
Entry
111166674         CDS       T05885                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04114  Oocyte meiosis
dle04140  Autophagy - animal
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04310  Wnt signaling pathway
dle04340  Hedgehog signaling pathway
dle04371  Apelin signaling pathway
dle04530  Tight junction
dle04540  Gap junction
dle04611  Platelet activation
dle04713  Circadian entrainment
dle04714  Thermogenesis
dle04720  Long-term potentiation
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04727  GABAergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04742  Taste transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04910  Insulin signaling pathway
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04924  Renin secretion
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04961  Endocrine and other factor-regulated calcium reabsorption
dle04962  Vasopressin-regulated water reabsorption
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04976  Bile secretion
dle05012  Parkinson disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05032  Morphine addiction
dle05034  Alcoholism
dle05146  Amoebiasis
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111166674 (PRKACA)
   04014 Ras signaling pathway
    111166674 (PRKACA)
   04310 Wnt signaling pathway
    111166674 (PRKACA)
   04340 Hedgehog signaling pathway
    111166674 (PRKACA)
   04371 Apelin signaling pathway
    111166674 (PRKACA)
   04020 Calcium signaling pathway
    111166674 (PRKACA)
   04024 cAMP signaling pathway
    111166674 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111166674 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111166674 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111166674 (PRKACA)
   04540 Gap junction
    111166674 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111166674 (PRKACA)
   04062 Chemokine signaling pathway
    111166674 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    111166674 (PRKACA)
   04910 Insulin signaling pathway
    111166674 (PRKACA)
   04922 Glucagon signaling pathway
    111166674 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    111166674 (PRKACA)
   04912 GnRH signaling pathway
    111166674 (PRKACA)
   04913 Ovarian steroidogenesis
    111166674 (PRKACA)
   04915 Estrogen signaling pathway
    111166674 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    111166674 (PRKACA)
   04921 Oxytocin signaling pathway
    111166674 (PRKACA)
   04926 Relaxin signaling pathway
    111166674 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    111166674 (PRKACA)
   04918 Thyroid hormone synthesis
    111166674 (PRKACA)
   04919 Thyroid hormone signaling pathway
    111166674 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    111166674 (PRKACA)
   04916 Melanogenesis
    111166674 (PRKACA)
   04924 Renin secretion
    111166674 (PRKACA)
   04925 Aldosterone synthesis and secretion
    111166674 (PRKACA)
   04927 Cortisol synthesis and secretion
    111166674 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111166674 (PRKACA)
   04270 Vascular smooth muscle contraction
    111166674 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    111166674 (PRKACA)
   04971 Gastric acid secretion
    111166674 (PRKACA)
   04976 Bile secretion
    111166674 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111166674 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    111166674 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    111166674 (PRKACA)
   04727 GABAergic synapse
    111166674 (PRKACA)
   04725 Cholinergic synapse
    111166674 (PRKACA)
   04728 Dopaminergic synapse
    111166674 (PRKACA)
   04726 Serotonergic synapse
    111166674 (PRKACA)
   04720 Long-term potentiation
    111166674 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    111166674 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    111166674 (PRKACA)
   04742 Taste transduction
    111166674 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    111166674 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    111166674 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    111166674 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111166674 (PRKACA)
   04714 Thermogenesis
    111166674 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111166674 (PRKACA)
   05205 Proteoglycans in cancer
    111166674 (PRKACA)
   05203 Viral carcinogenesis
    111166674 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111166674 (PRKACA)
   05020 Prion disease
    111166674 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    111166674 (PRKACA)
   05031 Amphetamine addiction
    111166674 (PRKACA)
   05032 Morphine addiction
    111166674 (PRKACA)
   05034 Alcoholism
    111166674 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111166674 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111166674 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166674 (PRKACA)
   05163 Human cytomegalovirus infection
    111166674 (PRKACA)
   05165 Human papillomavirus infection
    111166674 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111166674 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111166674 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111166674 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111166674 (PRKACA)
   03036 Chromosome and associated proteins [BR:dle03036]
    111166674 (PRKACA)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111166674 (PRKACA)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  PKA family
   111166674 (PRKACA)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111166674 (PRKACA)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111166674 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 111166674
NCBI-ProteinID: XP_022414311
UniProt: A0A2Y9LZR7
LinkDB
Position
Unknown
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgcggccaagaagggcagcgagcaagagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcccgctcagaatacagcccat
ctggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaagcacaaggagaccgggaaccactttgccatgaagatcctcgacaaacagaaggtg
gtaaagctgaagcagatcgagcacaccctgaacgaaaagcgcatcctgcaagcggtcaac
tttccgttccttgtcaaactcgagttctcgttcaaggacaactcaaatttatacatgatc
atggagtacgtgcctggtggggagatgttctcacacctgcggcggatcgggaggttcagt
gagccccatgcccgcttctacgcagcccagattgtcctgacctttgagtacctgcactcg
ctcgatctcatctaccgggacctgaagccggagaacctccttatcgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgc
ggcacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggcgttctcatctatgagatggccgctggctacccgcccttcttc
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccgtcc
cacttcagctccgacctgaaggatctgctgcggaaccttctgcaggtggacctcaccaaa
cgctttgggaacctcaagaacggggtcaatgacatcaagaaccacaagtggtttgccacg
accgactggatcgccatctaccaaaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Delphinapterus leucas (beluga whale): 111178380
Entry
111178380         CDS       T05885                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04020  Calcium signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04114  Oocyte meiosis
dle04140  Autophagy - animal
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04310  Wnt signaling pathway
dle04340  Hedgehog signaling pathway
dle04371  Apelin signaling pathway
dle04530  Tight junction
dle04540  Gap junction
dle04611  Platelet activation
dle04713  Circadian entrainment
dle04714  Thermogenesis
dle04720  Long-term potentiation
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04727  GABAergic synapse
dle04728  Dopaminergic synapse
dle04740  Olfactory transduction
dle04742  Taste transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04910  Insulin signaling pathway
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04922  Glucagon signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04924  Renin secretion
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04961  Endocrine and other factor-regulated calcium reabsorption
dle04962  Vasopressin-regulated water reabsorption
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04976  Bile secretion
dle05012  Parkinson disease
dle05020  Prion disease
dle05030  Cocaine addiction
dle05031  Amphetamine addiction
dle05032  Morphine addiction
dle05034  Alcoholism
dle05146  Amoebiasis
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111178380 (PRKACB)
   04014 Ras signaling pathway
    111178380 (PRKACB)
   04310 Wnt signaling pathway
    111178380 (PRKACB)
   04340 Hedgehog signaling pathway
    111178380 (PRKACB)
   04371 Apelin signaling pathway
    111178380 (PRKACB)
   04020 Calcium signaling pathway
    111178380 (PRKACB)
   04024 cAMP signaling pathway
    111178380 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111178380 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111178380 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111178380 (PRKACB)
   04540 Gap junction
    111178380 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111178380 (PRKACB)
   04062 Chemokine signaling pathway
    111178380 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    111178380 (PRKACB)
   04910 Insulin signaling pathway
    111178380 (PRKACB)
   04922 Glucagon signaling pathway
    111178380 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    111178380 (PRKACB)
   04912 GnRH signaling pathway
    111178380 (PRKACB)
   04913 Ovarian steroidogenesis
    111178380 (PRKACB)
   04915 Estrogen signaling pathway
    111178380 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    111178380 (PRKACB)
   04921 Oxytocin signaling pathway
    111178380 (PRKACB)
   04926 Relaxin signaling pathway
    111178380 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    111178380 (PRKACB)
   04918 Thyroid hormone synthesis
    111178380 (PRKACB)
   04919 Thyroid hormone signaling pathway
    111178380 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    111178380 (PRKACB)
   04916 Melanogenesis
    111178380 (PRKACB)
   04924 Renin secretion
    111178380 (PRKACB)
   04925 Aldosterone synthesis and secretion
    111178380 (PRKACB)
   04927 Cortisol synthesis and secretion
    111178380 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111178380 (PRKACB)
   04270 Vascular smooth muscle contraction
    111178380 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    111178380 (PRKACB)
   04971 Gastric acid secretion
    111178380 (PRKACB)
   04976 Bile secretion
    111178380 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111178380 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    111178380 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    111178380 (PRKACB)
   04727 GABAergic synapse
    111178380 (PRKACB)
   04725 Cholinergic synapse
    111178380 (PRKACB)
   04728 Dopaminergic synapse
    111178380 (PRKACB)
   04726 Serotonergic synapse
    111178380 (PRKACB)
   04720 Long-term potentiation
    111178380 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    111178380 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    111178380 (PRKACB)
   04742 Taste transduction
    111178380 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    111178380 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    111178380 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    111178380 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111178380 (PRKACB)
   04714 Thermogenesis
    111178380 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178380 (PRKACB)
   05205 Proteoglycans in cancer
    111178380 (PRKACB)
   05203 Viral carcinogenesis
    111178380 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111178380 (PRKACB)
   05020 Prion disease
    111178380 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    111178380 (PRKACB)
   05031 Amphetamine addiction
    111178380 (PRKACB)
   05032 Morphine addiction
    111178380 (PRKACB)
   05034 Alcoholism
    111178380 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111178380 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111178380 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111178380 (PRKACB)
   05163 Human cytomegalovirus infection
    111178380 (PRKACB)
   05165 Human papillomavirus infection
    111178380 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111178380 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111178380 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111178380 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111178380 (PRKACB)
   03036 Chromosome and associated proteins [BR:dle03036]
    111178380 (PRKACB)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111178380 (PRKACB)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  PKA family
   111178380 (PRKACB)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111178380 (PRKACB)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111178380 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 111178380
NCBI-ProteinID: XP_022436681
UniProt: A0A2Y9NUP4
LinkDB
Position
Unknown
AA seq 397 aa
MAAYRELPCNQYTGTTALQKLEGFASRLFHRHSKGTAHDQKTTLENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaactaccctgtaatcagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacactccaaaggtactgcacatgatcag
aaaacaactctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaaatgggaaaatcct
gctccgaataatgctgggctggaagattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgcaatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatacatggttatggaatatgtccctggtggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccatcaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagaaataattctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttccgga
aaggttcgattcccttctcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggacctgacgaagcggtttggaaatctaaagaatggtgtgagtgatataaaaact
cacaagtggtttgccacaactgattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagttcagaggctctggagataccagcaattttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtggaaaagaattttgtgaattttag

DBGET integrated database retrieval system