KEGG   Delphinapterus leucas (beluga whale): 111166690
Entry
111166690         CDS       T05885                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04145  Phagosome
dle04218  Cellular senescence
dle04514  Cell adhesion molecules
dle04612  Antigen processing and presentation
dle04940  Type I diabetes mellitus
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
dle05320  Autoimmune thyroid disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111166690
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111166690
   04145 Phagosome
    111166690
  09143 Cell growth and death
   04218 Cellular senescence
    111166690
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111166690
   04612 Antigen processing and presentation
    111166690
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111166690
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111166690
   05330 Allograft rejection
    111166690
   05332 Graft-versus-host disease
    111166690
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111166690
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111166690
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111166690
   05170 Human immunodeficiency virus 1 infection
    111166690
   05168 Herpes simplex virus 1 infection
    111166690
   05163 Human cytomegalovirus infection
    111166690
   05167 Kaposi sarcoma-associated herpesvirus infection
    111166690
   05169 Epstein-Barr virus infection
    111166690
   05165 Human papillomavirus infection
    111166690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111166690
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
    111166690
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111166690
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
 Antigens
  111166690
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3
Other DBs
NCBI-GeneID: 111166690
NCBI-ProteinID: XP_022414344
UniProt: A0A2Y9LX97
LinkDB
Position
Unknown
AA seq 559 aa
MCCQLPQTIGVFSCFLFPSPPEGAIKDLRAGPRVRAVEPQPEPGRSLNLSQGGVAAAAAL
GTLSALPPRPRRGTRPTVGRRPALARGPCPTAEDGLHRDRHPGAAREAADQAAAESRECA
GPAVAAATTAAAATAAVGTGAGGRSRCLQQRSRDSKTSVASIRDQSTGSANPAELCCLHS
AWEKGQTSARESPWGLPLVADSPAARAKVVMAELGHLKLEKKPWPTRTHSLHYYYLTLSE
PGPSLPKFLAVGYVDDQPFIRFDSRVGKAESQAPWMTPMDAQYWETETRKQEKWAEVQQV
EMWTVMGYHNHSSGMHSTQRMFGCEIQEDGRYRGFWQFGYDGQDHLSLDLETLSWVSAEP
VAMRTKHWWETERCYAEYDKAYLEGPCLASLHRYLELGGQRFSRREPPTVRITEHSAKDG
GTILRCWALGFYPHNILLSWWLGEKELDSEYAETRPSGDGTYQTWAAAWVPAGKKAQYTC
RVQHSSLNHTFTVSWESSHPGLTAMVISLVLVLLVVVGGVTLTKCIQARNKESYEQAPGG
EDPHNSQSPARAGATPLIC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtgctgtcaattaccgcaaacaattggggttttttcatgttttcttttcccgagccca
ccagagggcgccatcaaggacctgcgggcgggccccagggtgcgtgcggtggagccacag
ccagagcccggccggagcctgaacctgagccagggcggggtcgcagctgccgcggccctg
gggacactgagcgctctcccgcccagaccccggcgagggacgcgtcctactgtcggccgg
cggccggcgttggcacgaggcccctgccccacagctgaagacggactccaccgggaccgg
caccctggggcagcgcgtgaggctgccgatcaggcggccgcagagtcccgggagtgcgcg
ggaccggcggtcgccgccgccaccaccgctgctgctgctactgctgctgtcgggactggt
gcgggagggcgcagcaggtgtctgcaacaacggtcacgtgattcgaaaacatctgtggct
tctatcagagaccaaagcacaggttctgcaaatcctgctgagctctgttgcctccattca
gcatgggagaaaggccaaacttcagctagagagagtccctgggggctgcccttggtggcc
gatagcccggcggccagggcaaaggtggtgatggcagaactgggacacctgaagttggaa
aagaagccatggcctacaaggacacactcgctccactactactacctgaccctatcagag
ccaggcccaagcctccctaagtttctggctgtaggctacgtggacgaccagcccttcatc
cggtttgacagtcgtgtgggcaaggctgagtcccaggccccatggatgacgccaatggat
gcccagtactgggagacggagaccaggaagcaggagaaatgggcggaggtgcagcaggtg
gagatgtggacggtgatgggctaccacaaccacagcagtgggatgcacagcactcagcgc
atgttcggctgtgagatccaggaagacggccgctacaggggcttctggcagtttggctac
gatgggcaggaccacctgtcgctggacctggaaaccctgagctgggtgtcagctgagccc
gtggccatgcggaccaagcactggtgggagacagagcgctgctacgcagagtacgacaag
gcctacctggaaggcccctgccttgcctctctgcacagatacctggagctgggaggccag
agattcagccggagagagccacccacagtgcggataacagagcactcggccaaggatggc
ggcaccatcctgaggtgctgggccctgggcttctatccacacaacatcttgctgagctgg
tggctgggggagaaggaactggactccgagtatgcggagacacgccccagtggggacggc
acctatcagacgtgggcggctgcgtgggtgccggcggggaaaaaggcccagtacacctgc
cgcgtgcagcactccagcctgaaccacacgttcactgtgtcctgggagtcctctcatcct
ggacttactgccatggttatctccctcgtcctggtcttgctggtggtggttggtggtgtg
accttgaccaagtgcattcaagccaggaataaggaatcttacgagcaagccccaggtgga
gaggacccccataattcccaaagcccagcaagagcaggggctactccactcatctgctga

KEGG   Delphinapterus leucas (beluga whale): 111170644
Entry
111170644         CDS       T05885                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like isoform X1
  KO
K06751  MHC class I antigen
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04145  Phagosome
dle04218  Cellular senescence
dle04514  Cell adhesion molecules
dle04612  Antigen processing and presentation
dle04940  Type I diabetes mellitus
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
dle05320  Autoimmune thyroid disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111170644
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111170644
   04145 Phagosome
    111170644
  09143 Cell growth and death
   04218 Cellular senescence
    111170644
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111170644
   04612 Antigen processing and presentation
    111170644
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111170644
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111170644
   05330 Allograft rejection
    111170644
   05332 Graft-versus-host disease
    111170644
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111170644
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111170644
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111170644
   05170 Human immunodeficiency virus 1 infection
    111170644
   05168 Herpes simplex virus 1 infection
    111170644
   05163 Human cytomegalovirus infection
    111170644
   05167 Kaposi sarcoma-associated herpesvirus infection
    111170644
   05169 Epstein-Barr virus infection
    111170644
   05165 Human papillomavirus infection
    111170644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111170644
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
    111170644
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111170644
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
 Antigens
  111170644
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 111170644
NCBI-ProteinID: XP_022421786
UniProt: A0A2Y9MLD2
LinkDB
Position
Unknown
AA seq 360 aa
MGPRTLLLLLSGALALTETWAGSHSLRYFHTGVSRPGRWEPRFISVGYVDDTQFVRFDSD
APNPRKEPRAPWMEQEEPKYWEEETRISKENAQFYGVNLNILRGYYNQSEAGSHTLQEMY
GCDVGPDGRLLRGYRQLAYDGADYIALDEDLSSWTAADAAAQISKRKFEKAGAAEHHRAY
LDGACVEALRRYLENGKDTLQRADPPKTHVTHHPISDHEVTLRCWALGFYPKEISLTWQR
DGEDQTQDMELVETRPSGDGTFQKWVALVVPSGEEQRYTCHVQHKGLQEPLTLRWEPTQP
TVPIMGLIVGLVLLVVTGAVVTGAVIWRKKHSGEKGGSYAQAASSNSAQGSDVSLTDPKV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgggaccgcgaaccctcctcctgctcctctccggggccctggctctgaccgagacctgg
gcgggctcccactccctgaggtatttccacaccggcgtgtcccggccaggccgctgggag
ccccgcttcatctccgtcggctacgtggacgacacgcagttcgtgcggtttgacagcgac
gccccgaatccgaggaaggagccgcgggcgccgtggatggagcaggaggagccgaagtac
tgggaagaggagacgcggatctccaaggaaaacgcacagttttacggagtgaacctgaac
atactgcgcggctactacaaccagagcgaggccgggtctcacaccctccaggagatgtac
ggctgcgacgtggggccggacggtcgcctcctccgcgggtacagacagttagcctacgac
ggcgccgattacatcgccctggacgaggacctgagctcctggaccgcggccgacgcggcg
gctcagatctccaagcgcaagtttgagaaggccggtgctgcggagcaccacagagcctac
ctggatggggcatgcgtagaggcgctccgcagatacctggagaacgggaaggacacgctg
cagcgcgcagaccctccaaagacacacgtgacccaccaccccatctctgaccatgaggtc
accctgaggtgctgggccctgggcttctaccctaaggagatctcactgacctggcagcgt
gatggggaggatcagacccaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggtggccctggtggtgccttctggagaggagcagagatacacatgc
catgtgcagcacaaggggctccaggagcccctcaccctgagatgggaacctactcagccc
accgtccccatcatgggcctcattgttggcctggttctcttggtggtcactggagccgtg
gtgactggagctgtgatctggaggaagaagcactcaggtgagaaaggagggagctacgct
caggctgcaagcagtaacagtgcccagggctctgatgtgtctctcacggatcctaaagtg
tga

KEGG   Delphinapterus leucas (beluga whale): 111171394
Entry
111171394         CDS       T05885                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04144  Endocytosis
dle04145  Phagosome
dle04218  Cellular senescence
dle04514  Cell adhesion molecules
dle04612  Antigen processing and presentation
dle04940  Type I diabetes mellitus
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05203  Viral carcinogenesis
dle05320  Autoimmune thyroid disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
dle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111171394
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111171394
   04145 Phagosome
    111171394
  09143 Cell growth and death
   04218 Cellular senescence
    111171394
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111171394
   04612 Antigen processing and presentation
    111171394
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111171394
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111171394
   05330 Allograft rejection
    111171394
   05332 Graft-versus-host disease
    111171394
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111171394
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111171394
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111171394
   05170 Human immunodeficiency virus 1 infection
    111171394
   05168 Herpes simplex virus 1 infection
    111171394
   05163 Human cytomegalovirus infection
    111171394
   05167 Kaposi sarcoma-associated herpesvirus infection
    111171394
   05169 Epstein-Barr virus infection
    111171394
   05165 Human papillomavirus infection
    111171394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111171394
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
    111171394
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111171394
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dle00537]
 Antigens
  111171394
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 111171394
NCBI-ProteinID: XP_030616927
LinkDB
Position
Unknown
AA seq 345 aa
HRSPPPGSHSLRYFHTGVSRPGRWEPRFISVGYVDDTQFVRFDSDAPNPRKEPRAPWMEQ
EEPKYWEEETRISKENAQFYGVNLNILRGYYNQSEAGSHTLQEMFGCDVGPDGRLLRGYR
QSAYDGADYIALDEDLSSWTAADAAAQISKRKFEKAGAAEHHRAYLDGACVEALRRYLEN
GKDTLQRADPPKTHVTHHPISDREATLRCWALGFYPKEISLTWQRDGEDQTQDMELVETR
PSGDGTFQKWAALVVHSGEEQRYTCHVQHEGLQEPLTLRWEPLQPTVPIMGLIVGLVLLV
VTGAVVTGAVIWRKKHSGEKGGSYAQAASSDSSQGSDVSLMDPKV
NT seq 1038 nt   +upstreamnt  +downstreamnt
caccgctccccgcccccaggctcccactccctgaggtatttccacaccggcgtgtcccgg
ccaggccgctgggagccccgcttcatctccgtcggctacgtggacgacacgcagttcgtg
cggtttgacagcgacgccccgaatccgaggaaggagccgcgggcgccgtggatggagcag
gaggagccgaagtactgggaagaggagacgcggatctccaaggaaaacgcacagttttac
ggagtgaacctgaacatactgcgcggctactacaaccagagcgaggccgggtctcacacc
ctccaggagatgttcggctgcgacgtggggccggacggtcgcctcctccgcgggtacaga
cagtcagcctacgacggcgccgattacatcgccctggacgaggacctgagctcctggacc
gcggccgacgcggcggctcagatctccaagcgcaagtttgagaaggccggtgctgcggag
caccacagagcctacctggatggggcatgcgtagaggcgctccgcagatacctggagaac
gggaaggacacgctgcagcgcgcagaccctccaaagacacacgtgacccaccaccccatc
tctgaccgtgaggcgaccctgaggtgctgggccctgggcttctaccctaaggagatctca
ctgacctggcagcgtgatggggaggatcagacccaggacatggagcttgtggagaccagg
ccttcaggggacggaaccttccagaagtgggcggccctggtggtgcattctggagaggag
cagagatacacgtgccatgtgcagcacgaggggcttcaggagcccctcaccctgagatgg
gaacctcttcagcccaccgtccccatcatgggcctcattgttggcctggttctcttggtg
gtcactggagccgtggtgactggagctgtgatctggaggaagaagcactcaggtgagaaa
ggagggagctacgcccaggctgcaagcagtgacagttcccagggctctgatgtgtctctc
atggatcctaaagtgtga

DBGET integrated database retrieval system