KEGG   Delphinapterus leucas (beluga whale): 111167062
Entry
111167062         CDS       T05885                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04510  Focal adhesion
dle04650  Natural killer cell mediated cytotoxicity
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05100  Bacterial invasion of epithelial cells
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05220  Chronic myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111167062 (SHC1)
   04014 Ras signaling pathway
    111167062 (SHC1)
   04072 Phospholipase D signaling pathway
    111167062 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111167062 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111167062 (SHC1)
   04062 Chemokine signaling pathway
    111167062 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111167062 (SHC1)
   04915 Estrogen signaling pathway
    111167062 (SHC1)
   04917 Prolactin signaling pathway
    111167062 (SHC1)
   04926 Relaxin signaling pathway
    111167062 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    111167062 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111167062 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111167062 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111167062 (SHC1)
   05226 Gastric cancer
    111167062 (SHC1)
   05214 Glioma
    111167062 (SHC1)
   05220 Chronic myeloid leukemia
    111167062 (SHC1)
   05224 Breast cancer
    111167062 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    111167062 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111167062 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111167062 (SHC1)
   01522 Endocrine resistance
    111167062 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 111167062
NCBI-ProteinID: XP_022415164
UniProt: A0A2Y9LZK9
LinkDB
Position
Unknown
AA seq 609 aa
MENKPPPACPLLQLLPGGSLMHHPAMDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELP
SPSASSLGPMLPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKGEPGRAAEDGEGIV
GAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCDAVPGAKGATRRRKPCSRP
LSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVA
YVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGS
AWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGVPQGAARPTPPSAQTPSHLGATLP
VGQPVGGDPEARKQMLPPPPCPAGRELFDDPSYVNVQNLDKARQAGGGAGPPNPAINGST
PRDLFDMKPFEDALRVPPPPQLVAMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVREST
TTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELC
LQQPVERKL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggagaacaagcctccaccagcctgtcctctgctccagctcctgcctggtggctccctg
atgcaccacccagccatggatctcctgccccccaagcccaagtacaacccacttcggaat
gagtctctgtcatcgctggaggagggagcttcagggtccaccccaccggaggagctgcct
tccccatcagcctcgtctctggggcccatgctgccgcctctgcctggggacgatagtccc
actaccctgtgctccttcttcccccggatgagcaacctgaagctggccaacccggctggg
gggcgcctggggccgaagggggagccaggaagggcagccgaggatggggaggggatcgta
ggggcagccatgccggactcaggccccctgcccctcctccaggacatgaacaagctgagt
ggaggcggcgggcgcaggactcgggtggaagggggccagctggggggcgaggagtggacc
cgccacgggagctttgtcaataagcccacgcggggctggctgcatcccaacgacaaagtc
atgggacccggggtttcctacttggttcggtacatgggctgtgtggaggtcctgcagtca
atgcgcgccctggacttcaacacccggactcaggtcaccagggaggccatcagtctggtg
tgtgacgctgtgccgggtgctaagggggcaacaaggaggagaaagccctgtagccgtcca
ctcagctccatcctggggaggagtaacctgaaatttgctggaatgccaatcactctcacc
gtctccaccagcagcctcaacctcatggccgcagactgcaaacagatcatcgccaaccac
cacatgcaatccatctcgtttgcgtctggcggggacccggacacagccgagtatgtcgcc
tatgttgccaaagacccggtgaatcagagagcctgccacatcctggagtgtcccgaaggg
cttgctcaggacgtcatcagcaccattggccaggccttcgagttgcgtttcaaacaatac
ctcaggaacccgcccaagctggtcaccccccatgacaggatggctggctttgatggctca
gcttgggatgaggaggaagaagagccacctgaccatcagtactataatgacttccctggg
aaggaaccccctcttgggggggtggtggacatgagacttcgggaaggagtcccccagggg
gctgctcgacccactccacccagtgcccagacccctagccacctgggagccacgctgcca
gtggggcagcctgttggaggagacccagaagcccgcaaacagatgctgcccccgccaccc
tgcccagcaggcagagagctctttgatgatccctcctatgtcaatgtccagaacctagac
aaggcacggcaagcaggcggtggggccgggccccccaatcctgccatcaatggcagcacg
ccccgagacctctttgacatgaagccctttgaagatgccctgcgggtgcctccacctccc
cagttggtggccatggctgagcagctccgaggggagccctggtttcacgggaagctgagc
cggcgggaggccgaggcactgctacagctcaacggggacttcctggtgcgggaaagcacg
accacgcctggccagtatgtgctcactggcctgcagagtgggcagcccaagcacctgcta
ctggtggaccctgagggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcac
ctcatcagctaccacatggacaatcacttgcccatcatctctgcgggcagcgaactgtgt
ctccagcaacctgtggagcggaagctgtga

KEGG   Delphinapterus leucas (beluga whale): 111167641
Entry
111167641         CDS       T05885                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04510  Focal adhesion
dle04650  Natural killer cell mediated cytotoxicity
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05100  Bacterial invasion of epithelial cells
dle05214  Glioma
dle05220  Chronic myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111167641 (SHC3)
   04014 Ras signaling pathway
    111167641 (SHC3)
   04072 Phospholipase D signaling pathway
    111167641 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111167641 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111167641 (SHC3)
   04062 Chemokine signaling pathway
    111167641 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111167641 (SHC3)
   04915 Estrogen signaling pathway
    111167641 (SHC3)
   04917 Prolactin signaling pathway
    111167641 (SHC3)
   04926 Relaxin signaling pathway
    111167641 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    111167641 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111167641 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111167641 (SHC3)
   05226 Gastric cancer
    111167641 (SHC3)
   05214 Glioma
    111167641 (SHC3)
   05220 Chronic myeloid leukemia
    111167641 (SHC3)
   05224 Breast cancer
    111167641 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    111167641 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111167641 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111167641 (SHC3)
   01522 Endocrine resistance
    111167641 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 111167641
NCBI-ProteinID: XP_022416391
UniProt: A0A2Y9M5N9
LinkDB
Position
Unknown
AA seq 588 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRRAPDDGP
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAAPDGSAPPGPRAPAMR
AARKGRPGDEPPPRAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQEVIGSIGQAFELRFK
QYLQCPSKIPALHDRMQSLDEPWTEEEGEGADHPYYNSIPSKMPPPGGFVDARLKARLHG
PDTAQFAGKEQTYYQGRHLGDPLGEDWQQTPVRQGSLDIYSMPERKSHVAPTGEAPTYVN
TQCIPLQAGLATGSSAESSPRKDLFDMKPFEDALKNQSLGPVLSKAASVECISPVSPRAP
DAKMLEELKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLL
VDPEGTIRTKDRIFDSINDLINHHLENSLPIVSAGSELCLQQPVERNP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaatcgcttcaggaatgactcggtgacatcggtcgatgac
cttctgcacaacctgtcggtgagcggcggtggcaaggtctcggcggcgcgcgcggccccg
gcggcggccccctacctggtgtccggagacgcgctgcgcagggcgcccgacgatgggccg
ggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggcctc
cgcggcctgtcggcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggccgccccggacggcagcgcgccccccggcccccgcgccccggccatgcgc
gccgccaggaagggccgaccaggcgacgagccgccgccccgcgccccgcacgctagcgac
caggtgctgggggccggagtcacctacgtcgtcaagtacttggggtgcattgaagttctt
cgctcaatgaggtcacttgacttcagtacaaggacacaaattaccagggaagccatcagc
cgggtttgcgaagccgtccctggcgccaagggagccttcaggaaaagaaagcctccgagc
aaaatgttgtccagcatcctgggcaagagcaacctccagtttgcggggatgagcatctcc
ctgaccatatccaccgccagcctgaacctgcggaccccagactcgaaacagattatagcg
aatcatcacatgcagtccatctcctttgcctctggcggagacccggatacaacagactat
gttgcgtacgtagctaaggaccctgttaatcgcagagcttgtcacattctggaatgctgt
gacgggctggcccaggaggtcatcggctccatcggacaagcctttgagctccggtttaag
caatatttgcagtgtccttccaagatccctgctctccacgaccgaatgcagagtctagat
gagccctggactgaagaggagggtgagggcgcagaccacccgtactacaacagcattcca
agcaagatgcctcctccagggggctttgtagatgctcgactgaaagccagactccatggt
cctgacacagcccagtttgcaggaaaagagcaaacttactaccaggggagacacttagga
gacccgcttggcgaagactggcagcaaacacctgtgaggcaagggtccttggacatctac
agcatgccggaaaggaaatcgcatgtggcccctacgggagaagcccccacctatgtcaac
acccagtgcatcccgctgcaggctgggctggccacgggcagcagtgcagaaagcagccca
cggaaagacctctttgacatgaaaccttttgaagatgctctcaagaaccagtccttgggg
cctgtgttgagcaaggcagcctccgtggagtgcatcagccccgtctcacccagagccccg
gatgctaagatgctggaagagctgaaagcagagccttggtaccaaggggagatgagcagg
aaggaggcagaggggctactgaagagagatggagacttcctggtcaggaagagcaccacc
aacccaggctcctttgtcctcactggcatgcacaatggccaggccaagcacctgctgctc
gtggacccagaaggcacgatccgcacaaaggacaggatctttgacagtatcaacgacctc
atcaaccaccacctggagaacagcctgcccattgtctctgccgggagcgagctctgcctt
cagcagccggtggagaggaacccgtga

KEGG   Delphinapterus leucas (beluga whale): 111170483
Entry
111170483         CDS       T05885                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2 isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04370  VEGF signaling pathway
dle04510  Focal adhesion
dle04650  Natural killer cell mediated cytotoxicity
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05100  Bacterial invasion of epithelial cells
dle05214  Glioma
dle05220  Chronic myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111170483 (SHC2)
   04014 Ras signaling pathway
    111170483 (SHC2)
   04370 VEGF signaling pathway
    111170483 (SHC2)
   04072 Phospholipase D signaling pathway
    111170483 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111170483 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111170483 (SHC2)
   04062 Chemokine signaling pathway
    111170483 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111170483 (SHC2)
   04915 Estrogen signaling pathway
    111170483 (SHC2)
   04917 Prolactin signaling pathway
    111170483 (SHC2)
   04926 Relaxin signaling pathway
    111170483 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    111170483 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111170483 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111170483 (SHC2)
   05226 Gastric cancer
    111170483 (SHC2)
   05214 Glioma
    111170483 (SHC2)
   05220 Chronic myeloid leukemia
    111170483 (SHC2)
   05224 Breast cancer
    111170483 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    111170483 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111170483 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111170483 (SHC2)
   01522 Endocrine resistance
    111170483 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 111170483
NCBI-ProteinID: XP_022421363
UniProt: A0A2Y9MVZ5
LinkDB
Position
Unknown
AA seq 588 aa
MTQGPGGRAAPPPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRGPAAARAAGGAGPA
GGAEPEPEPAASAGSAGVPALAAAVLGACEPRCTAPCPLPALSRCRAAGARGSRGARGAA
GPPDSAADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFSTR
TQLTREAINRLHEAVPGIRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISIDGLNLSV
PATHQIIASHHMQSISFASGGDTDMVDYVAYVAKDPINQRACHILECCEGLAQSVISTVG
QAFELRFKQYLHSPPRVVVPPGRLTGPEDSAWGDEDETEHSYYNRTPGKEPPLGGLVDSR
LTPAQQPCALGALGQGASPARRDARGPQWDVGPSAPPGDGYVQADPRGPRDYEDHLYVNT
QGLDGPETLQPEDSPKKDLFDMRPFEDALRLHECSVAAGPAAAPLPVEDQWPSPPTRRAP
IAPTEEQLRQEPWYHGQMSRRAAEKLLRVDGDFLVRDSVTNPGQYVLTGMHAGQPKHLLL
VDPEGVVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVRREP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcggcccccccgccccccgcacccccggagcctgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgcggcccca
gccggcttcctgggccgcggcccggcggcggcgcgggctgcgggaggcgcggggccggcg
gggggagccgagcccgagcccgagccggccgcctcggccggctcggccggcgtcccggcg
ctggcggcggcggtcctgggcgcctgcgagccgcgctgcaccgcgccctgccccctgcct
gcgctcagccgctgccgggctgccggggcgcgggggtcgcggggcgcgcggggggcagcc
gggcccccggactccgccgccgacgagtggatccgcaaaggcagcttcatccacaagccg
gcgcacggctggctacacccggacgccagggtcctggggcccggggtctcctacatcgtt
cggtacatgggctgcatcgaagtcctccgttccatgcgctccctggacttcagcactcgc
acccagctcaccagggaagccatcaaccggctccatgaggccgtgcctggcatccggggc
tcctggaagaagaaggcccccaacaaggcactggcctccatcctgggcaagagcaacctg
cgcttcgcgggcatgagcatcgccgtcagcatctccatcgacggcctcaacctctccgtt
cccgccacgcaccagatcatcgccagccaccacatgcagtccatctcctttgcgtcgggt
ggtgacacggacatggtggattatgtggcctacgtggccaaggaccccatcaaccagaga
gcctgccacatcctggagtgctgcgagggcctcgcccagagcgtcatcagcaccgtgggc
caagccttcgagctgcgcttcaaacagtacctgcacagcccccccagggttgtcgtcccc
ccgggaaggctgaccgggccggaggattcggcctggggggacgaggacgagacagaacac
agctactacaaccgcactcccgggaaggagccgcccctgggcgggctggtggactccagg
ctcacccccgcgcagcagccctgtgccctcggggcccttggccagggagcatctcctgct
cgaagagacgcccgaggcccgcagtgggatgtgggcccctcagccccgcccggggatggc
tacgtgcaggcagacccgcggggcccgcgagactacgaggaccacttgtacgtcaacacg
caaggtctggacggcccggagaccctgcagcctgaggacagccccaagaaggacctgttc
gacatgagacccttcgaggatgccctgaggctgcacgagtgctccgtggccgcgggtccg
gcggcagcccctcttcccgtggaggaccagtggcccagcccgccgacccgccgggccccc
atcgcccccacggaagagcagctgcggcaggagccctggtaccacggccagatgagccgt
cgggcggcggagaaactgcttcgagtggacggggacttccttgtgcgggacagcgtcacc
aacccggggcagtatgtcctcaccggcatgcacgcagggcagcccaagcacctgctgctc
gtggaccccgaaggcgtggtgcggacgaaggacgtgctcttcgagagcatcagccacctg
atcgactaccacctgcagaacgggcagcccatcgtggccgccgagagcgagctgcacctg
cgtggtgtcgtcaggcgggaaccctga

KEGG   Delphinapterus leucas (beluga whale): 111181617
Entry
111181617         CDS       T05885                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04510  Focal adhesion
dle04650  Natural killer cell mediated cytotoxicity
dle04722  Neurotrophin signaling pathway
dle04910  Insulin signaling pathway
dle04915  Estrogen signaling pathway
dle04917  Prolactin signaling pathway
dle04926  Relaxin signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05034  Alcoholism
dle05100  Bacterial invasion of epithelial cells
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05220  Chronic myeloid leukemia
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111181617 (SHC4)
   04014 Ras signaling pathway
    111181617 (SHC4)
   04072 Phospholipase D signaling pathway
    111181617 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111181617 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111181617 (SHC4)
   04062 Chemokine signaling pathway
    111181617 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111181617 (SHC4)
   04915 Estrogen signaling pathway
    111181617 (SHC4)
   04917 Prolactin signaling pathway
    111181617 (SHC4)
   04926 Relaxin signaling pathway
    111181617 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    111181617 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111181617 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111181617 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111181617 (SHC4)
   05226 Gastric cancer
    111181617 (SHC4)
   05214 Glioma
    111181617 (SHC4)
   05220 Chronic myeloid leukemia
    111181617 (SHC4)
   05224 Breast cancer
    111181617 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    111181617 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111181617 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111181617 (SHC4)
   01522 Endocrine resistance
    111181617 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 111181617
NCBI-ProteinID: XP_022442863
UniProt: A0A2Y9PJL2
LinkDB
Position
Unknown
AA seq 630 aa
MRERGPDSLAGLVLYVGLFRHPGMLHRAKYSRFRNESITSLDEGSPGGSGGNKGSPQPPY
PALAPHVPAEDATLASQESPTPLCTLIPRMASVKLANPGTLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLNRAMPAPPPQRDALGHRATSLTPDACPLPGPGEPTPGSRQDKH
FLRHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPAKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECSNGMAQDVISTIGQAFELRFKQYLKNPSLNTSSESEEV
HVDDHAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQTTEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAHERGVQSQRDTSLMKPACRVDLFDDPCYINTQTLQSTLGSAGN
QSPAHPLGTPWYREKAPETVQPGATAQPASSRSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPVLLHSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtccggacagcctggcaggactcgtgctgtatgtaggactcttcagg
caccccgggatgctgcacagggccaagtatagccgctttcggaatgagtccatcacgtcc
ttggacgaaggcagccccggaggctcgggggggaacaagggctcgccgcagcctccctac
cccgccctggcacctcacgtgccggctgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatggccagcgtaaagctggccaacccaggcacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtacctcgactcaagctccag
gaaagccaagacccggctcccagcagcccggcttcccctgaaaccagtctgaatagggcc
atgccagcacctccgcctcagcgggacgccctggggcacagggcgacctctttaactcct
gatgcctgcccccttcccggccctggggagccaacccccgggagcaggcaggacaagcac
tttctgcggcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaggtgctgcaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagctaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatataaaactgaccatctcaacatgcagcctcacattgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcttctggaggggatccggatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgcagcaatggaatggcccaagacgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttctgaaagtgaggaggtg
cacgttgatgaccatgctgaggagagagaagatcatgagtattacaatgaaatcccgggc
aagcagccgcctgcaggtggtgtttcagatgtacggatcaaagttcaaaccacagaacaa
atggcttactgccccatacggtgtgaaaagttgtgctatttgccgggaaactccaagtgc
agcagtgtgtatgagaactgtctagaacaaagcagggcaataggtaatgcacacgagaga
ggggtacagtcccaaagagacacgtcattgatgaagcccgcgtgccgagtggatctcttc
gacgacccctgctacatcaatacgcagactcttcaaagcacgctgggctctgccggaaat
caaagtccagctcacccactggggaccccatggtaccgtgaaaaggcaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcacgttctttgccacacattaagcagcag
ctgcggaatgaagactgctaccacggcaagctgagcaggaaagcagcagagagcctcttg
gtaaaggatggggactttttggttcgagagagcgcaacatctcctggccagtatgtgctg
agtgggctacagggaggccaggcaaaacatcttctcctggtggatcccgaaggcaaggtg
aggaccaaggatcatgtatttgataatgttggccaccttatcagataccacatggataat
agtttgccaatcatctcttctggaagcgaagtaagccttaaacaaccagtgagaaaagat
aataatccagtacttttgcattccaacaaatga

DBGET integrated database retrieval system