KEGG   Delphinapterus leucas (beluga whale): 111167305Help
Entry
111167305         CDS       T05885                                 

Gene name
CNDP1
Definition
(RefSeq) beta-Ala-His dipeptidase isoform X1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00330  Arginine and proline metabolism
dle00340  Histidine metabolism
dle00410  beta-Alanine metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    111167305 (CNDP1)
   00340 Histidine metabolism
    111167305 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111167305 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dle01002]
    111167305 (CNDP1)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     111167305 (CNDP1)
Peptidases [BR:dle01002]
 Metallo Peptidases
  Family M20
   111167305 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 111167305
NCBI-ProteinID: XP_022415731
UniProt: A0A2Y9M3T9
LinkDB All DBs
Position
Unknown
AA seq 506 aa AA seqDB search
MDPIVGRMASSLLAFLLLLDGGMFSPSSPPTGLLEKVFQYIDLHQDEFVQTLKEWVAVES
DSVQPVLHLRRELLRMTGLAADRLRNLGAHVDLVDAGFQQLPDGQSLPIPPIILAELGND
PKKPTVCFYGHLDVQPARQEDGWVTDPHTLTEVDGKLYGRGTTDNKGPVLAWINAVSTFR
ALDEDLPVNVKFVIEGMEEAGSLALEELVQKEKAGFFSSVDYIVISDNLWISRRTPALTC
GTRGNSYFMVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGRILIPGIYDHVAP
VTEEEKRTYEAIDLDLEEYRNSSQVKKFLFDTKEELLMHLWRYPSLSIHGIEGAFHEPGA
KTVIPGRVIGKFSIRLVPHMNISVVEKQVKQHLDYIFSKRNSSNQMTVSMTLGLHPWVAN
IRDNQYLAAKRAIKTVFGTEPDMIRDGSTIPIAKIFQDTIQKSVMMLPLGAVDDGEHSQK
EKINRWNYIEGSKLFAAFFLEMAKLH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatcccatagtaggaaggatggcatcatctctccttgctttcctgttgctgctggac
ggaggcatgttctcaccgtcctccccgcccaccgggctgctagagaaggtcttccaatac
atcgatctccatcaggatgaatttgtacagacgctgaaggagtgggtggcggtcgagagc
gactcggtccagcccgtgctgcacctccgacgagagctgctcagaatgacaggcctggct
gcagaccggctccggaacctgggagcccacgtggacttggtggacgcaggttttcagcag
ctgcctgatggtcagagcctcccgatacctcccatcatcctggccgaactggggaatgat
cccaagaagcccaccgtgtgcttctacggccacttggacgtgcagcctgccagacaggag
gatgggtgggtcacggaccctcacacgctgacggaggtggatggaaaactgtatggccga
ggaacgacagacaacaaaggccctgttttagcgtggatcaacgctgtgagcacattcaga
gccctggacgaggatctgcccgtgaacgtcaaatttgttatcgaggggatggaggaggct
ggttctcttgccctggaggaacttgtccagaaagagaaggccgggttcttctcaagtgta
gactacatcgtgatttcagacaatctgtggatcagccggaggacgcccgcgctcacgtgt
gggacgcgagggaacagctacttcatggtggaggtgaagtgcagagatcaggatttccac
tcggggacctttggtgggatccttaacgaacccatggcggatctggtcgctcttcttggc
agcctggtggactcttctggtcgaattctgatccctggaatctatgaccacgtggctcct
gttacagaggaggaaaagagaacatacgaagccatcgatctggacctcgaggagtaccgg
aacagcagccaggttaagaaatttctgtttgacaccaaggaggaacttctgatgcacctg
tggagatacccatctctttctattcatgggatcgagggcgcgtttcatgagcctggagcc
aaaacagtcatccctggccgagtgataggaaaattttcaatccgtctggtccctcacatg
aatatatctgtggtggagaagcaggtgaagcagcatcttgactatatattctccaaaaga
aatagctccaaccagatgactgtatctatgacgctaggactacacccgtgggttgcaaat
atcagagataatcagtatcttgcggcaaaaagagccatcaaaacagtgtttgggacagag
ccagacatgatccgagatggatcaaccatacccattgccaaaatattccaggataccatc
cagaagagtgtgatgatgctcccgctgggcgctgtggatgatggagagcactctcagaaa
gagaaaatcaacaggtggaattacatagagggatccaaattatttgctgcctttttccta
gagatggctaagctgcattaa

DBGET integrated database retrieval system