KEGG   Delphinapterus leucas (beluga whale): 111167490
Entry
111167490         CDS       T05885                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL isoform X1
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04144  Endocytosis
dle04910  Insulin signaling pathway
dle05100  Bacterial invasion of epithelial cells
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111167490 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111167490 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111167490 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111167490 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111167490 (CBL)
   05205 Proteoglycans in cancer
    111167490 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111167490 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111167490 (CBL)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111167490 (CBL)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111167490 (CBL)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    111167490 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 111167490
NCBI-ProteinID: XP_022416130
UniProt: A0A2Y9M339
LinkDB
Position
Unknown
AA seq 910 aa
MAGNVKKSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYEDDDDERADDPLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLQQRISIPSSASGLGTASKAPSGSLHKDKPLPIPPTLR
DLPPPPPPDRPYSGGAETRPQRRPLPCTPGDCPSRDKLPPVPSGRAGEASWLPRPIPKVP
VAAPNPSDPWTGRELTNRHSLPFSLPSQMEPRTDVPRLGSTFSLDTSMNTNSSPLAGPEC
EHPKIKPSASANAIYSLAARPLPVPKPPPGEQCESEEDTEYMTPSSRPVGLQKPEVKWPL
ETTQSSRACDCNQQIDSCTYEAMYNIQSQAAPSVTESGTFGEGNLAAAHANTGPEESENE
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLEGDPTTNFTEGSQVPERPPKPFPRR
INSERKAGSCQQSTAATSPQLSSEIESLMSQGYSYQDIQKALVIAHNNIEMAKNILREFV
SISSPAHVAT
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggccggcaatgtgaaaaagagctctggggccgggggcggcggcggctccgggggttcg
ggctcgggaggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccaccctccggggaccgtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctgccagacacctaccagcatctccgcactatcttgtca
agatatgaggggaagatggagacccttggagaaaatgagtattttagggtgttcatggag
aatttgatgaagaaaactaagcagaccataagcctcttcaaggaggggaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctgatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcaaggagacacatttcgg
attactaaagcggatgctgcagaattttggagaaaagcttttggggaaaagacaatagta
ccttggaagagcttcagacaggcccttcatgaagtacatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcagtgtttgaa
ttcgacatctttacacgactctttcagccctggtcttctttgctcaggaactggaacagt
cttgctgtaactcatcctggttacatggctttcctgacatatgatgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttacattttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgtcactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcgctgattgatggcttcagggaaggcttctatttgtttcct
gatggacggaatcagaatccagacctgacaggcttatgtgaaccaactccccaagaccac
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaactg
tgtaaaatatgtgctgaaaatgataaagatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtctaacatcctggcaggaatcagaaggccagggctgtcccttctgccga
tgtgaaattaaaggtactgagcccattgtggtcgatccctttgatcctagaggaagtggc
agcctgctgaggcaaggagcagagggagctccctccccaaattacgaggatgatgacgat
gaacgagctgatgatcctctcttcatgatgaaagaattggctggtgccaaggtggaacga
cctccttctccattctccatggccccacaagcttcccttcccccagtgccaccacggctt
gaccttctacaacagcgaatatctattccttcaagtgcttctggtcttggaactgcttct
aaggctccttctggctcccttcataaggacaaaccattaccaatacctcccactcttcga
gatcttccaccaccaccccctccagaccggccatattctggtggagcagaaacacggcct
cagagacgccccttgccctgtacaccaggcgactgtccgtccagagacaaactgccccct
gtcccctctggccgcgctggagaagcatcatggctgcctcggccaatccccaaagtacca
gtagctgcgccaaaccctagtgacccctggacagggagagaattaaccaaccggcactca
cttccattttccttgccctcacaaatggaacccagaaccgatgtgcctaggcttggaagc
acattcagtctggatacctccatgaatacgaatagcagcccgttagcaggtccagagtgt
gagcatcccaaaatcaaaccttctgcatctgccaatgccatttattctctggctgccaga
cctcttcctgtgccaaaaccgccacctggggagcagtgtgaaagtgaggaggacacagag
tatatgactccttcctctaggcctgtgggacttcaaaagccagaagtgaagtggcctctg
gagacaacccagagttcacgagcctgtgattgtaaccagcagatcgatagttgtacatac
gaagcaatgtataatattcagtcccaggcggcaccgtctgtcacagagagcggcaccttt
ggtgaagggaatttggctgcagcccatgccaacactggccctgaggaatcagaaaatgaa
gatgacgggtacgatgtccccaagccacctgtgcccgcagtgctggcccgccgcacgctc
tctgacatctccaacgccagctcctctttcggctggctgtctctggaaggtgatcccaca
acgaacttcactgagggttcccaagttcctgagaggccacccaaaccgttccctcggaga
atcaactctgaacgaaaagcaggtagctgtcagcaaagcaccgccgccacctcaccgcag
ctctccagtgagattgagagcctcatgagtcagggatactcctaccaggacattcagaaa
gctctggtcattgcccacaacaatattgaaatggccaaaaacatcctccgggaatttgtt
tctatttcttctcctgcccatgtagccacctag

KEGG   Delphinapterus leucas (beluga whale): 111185062
Entry
111185062         CDS       T05885                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04012  ErbB signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04144  Endocytosis
dle04625  C-type lectin receptor signaling pathway
dle04660  T cell receptor signaling pathway
dle04910  Insulin signaling pathway
dle05162  Measles
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111185062 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111185062 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111185062 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111185062 (CBLB)
   04660 T cell receptor signaling pathway
    111185062 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111185062 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    111185062 (CBLB)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111185062 (CBLB)
Membrane trafficking [BR:dle04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111185062 (CBLB)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    111185062 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 UBA zf-RING_4
Other DBs
NCBI-GeneID: 111185062
NCBI-ProteinID: XP_022449986
UniProt: A0A2Y9PXU9
LinkDB
Position
Unknown
AA seq 983 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPHPDPLQIPHLSLPPVPPRLDLIQKGVVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFLHMESVPSRDQPMPLEAWCPRDVLG
TNQSVGCRLLGDASPKPGITASSNVNGRHSRMGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPAATLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPPRSCDNGHCILNGTHGTSSEMKKSNIPELGIYLKGDVFDSASDPVPLP
PARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPP
GSSSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYDQLPSSSDGS
QAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNN
VEVARSILREFAFPPPVSPRLNL
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaaccctggtggtcgaggaggaaacccccgaaaagga
cgaattttgggtattattgatgctattcaagatgcagttggaccccctaagcaagcagca
gcagatcgcaggactgtggagaaaacttggaaactcatggacaaagtggtcagactgtgc
caaaatcccaaactccagttgaagaatagcccaccgtatatacttgatattttacctgat
acatatcagcatttgagacttatattgagtaaatatgacgacaaccagaaacttgcccaa
ctcagtgagaatgaatattttaaaatctacattgatagtctaatgaaaaagtcaaaaaga
gcaataagactctttaaagaaggcaaggagaggatgtacgaagagcagtcgcaggacaga
cgaaatcttacaaaactctcccttatcttcagtcacatgttggcagaaatcaaagctatc
tttcccaatgggcaattccagggagataacttccgtatcacgaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactattgtaccatggaaagtattcagacagtgc
cttcatgaggtccatcagattagctctggtctggaagcaatggctctaaaatcaacaatt
gatttaacttgtaatgattacatttcagtttttgaatttgatatttttaccaggctattt
cagccttggggctctattttacggaattggaatttcttagctgtaacacatccgggttac
atggcatttctcacgtacgatgaagtaaaagcacggctacagaaatacagcactaaaccc
ggaagctacattttccggttaagctgcactaggttgggacagtgggccatcggctatgtg
acaggggatggaaatatcttacagaccataccgcacaacaagcccttatttcaagccctg
atcgacggcagcagggaaggattctatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacaccccatgatcatataaaagttacacaggaacaatat
gaattatattgtgaaatgggttccacttttcagctctgtaaaatttgtgctgagaacgac
aaagatgtcaagattgagccttgtgggcatttgatgtgtacctcttgccttacagcctgg
caggagtcagatggccagggctgccccttctgtcgctgcgaaataaaaggaacggagccc
ataatcgtggacccctttgatccaagagatgaaggttccaggtgctgtagcatcattgac
cccttcggaatgccgatgctggacttggatgacgatgatgaccgagaggagtccttgatg
atgaatcggttggcaaatgttcgaaagtgcactgacaggcagaattccccagtcacatca
ccgggatcctctccccttgcacagcgaagaaagccacatccagaccctctccagatccca
catttaagcctgccaccagtgcctcctcgcctggatctaattcagaaaggcgtagttcgg
tctccctgtggcagcccaactggttcaccaaagtcttctccttgcatggtgagaaaacaa
gacaaaccactcccagcaccaccacctcccttaagagaccctcctcctcctccacctgag
agacctcccccaatcccccctgacaatagactgagtcgtcacttccttcacatggaaagt
gtgccttccagagaccagccgatgcctctggaagcctggtgtcctcgggatgtgcttggg
actaatcagtcagtgggatgtcgcctcctaggggatgcctctccaaagcctggaatcaca
gcgagttcaaatgtgaatggaaggcacagtagaatgggctctgacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggagccaaggtcttttccaatggtcacctg
ggaagtgaagaatatgatgttcctccccggctttctcctccccctccagctgccaccctt
ctccccagcatcaagtgtactggtccattagcaaattccctttcagagaaaacaagagac
ccagtagaggaagatgacgatgaatacaagattccttcatcccatcctgtttccctgaat
tcacaaccatctcattgtcataatgtaaaacctcctcctaggtcttgtgataacggtcac
tgcatattgaatggaacacacggtacgtcttcagagatgaagaaatcaaacatccctgag
ttaggcatatatttaaagggagatgtttttgattcagcctctgatccagtgccattacca
cctgccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccc
tctgattatgatcttctcatccctccattaggtgaagatgcttttgatgccctcccccca
tccctcccacctcccccacctcccgcaaggcatagtctcatcgaacattcaaaacctcct
ggctccagtagccgaccatcctcaggacaggaccttttcctccttccttcagatcccttc
tttgatccagcaagtggccaggttcctttgcctcctgctaggagattaccaggtgaaaat
gtcaaatccaacagaacatcacaggactatgatcagcttccttcatcttcagatggttca
caagcaccagccagacctcctaaaccacgaccccgcaggactgcaccagaaattcaccac
agaaaaccccacgggcctgaggcagcattggaaaacgtcgatgcaaaaattgcaaaactc
atgggagagggttatgcctttgaagaagttaagagagccttagagatagcccagaataat
gtcgaagtggcccgtagcatcctccgagaatttgccttcccccctcccgtctccccacgt
ctaaatctatag

DBGET integrated database retrieval system