KEGG   Delphinapterus leucas (beluga whale): 111167503
Entry
111167503         CDS       T05885                                 

Gene name
EZR
Definition
(RefSeq) ezrin
  KO
K08007  villin 2 (ezrin)
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04530  Tight junction
dle04670  Leukocyte transendothelial migration
dle04810  Regulation of actin cytoskeleton
dle04971  Gastric acid secretion
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111167503 (EZR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111167503 (EZR)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111167503 (EZR)
  09154 Digestive system
   04971 Gastric acid secretion
    111167503 (EZR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111167503 (EZR)
   05205 Proteoglycans in cancer
    111167503 (EZR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111167503 (EZR)
   04147 Exosome [BR:dle04147]
    111167503 (EZR)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     111167503 (EZR)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111167503 (EZR)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N RCR
Other DBs
NCBI-GeneID: 111167503
NCBI-ProteinID: XP_022416154
UniProt: A0A2Y9M274
LinkDB
Position
Unknown
AA seq 586 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYGKELHKSGYLGSERLIPQRVMDQHKLTRDQWEDRIQVWHTEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKQQKQLERQQLETEKKRRETVEREKEQMVREKEELMLRLQDYAEKTRK
AEKELSDQIQRALKLEEERKRAQEESERLEAERLAALHAKDELERQAADQIKSQEQLATE
LAEYTAKIALLEEARRRKEDEVEEWQLRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VNYHVQENPQEEGTEYPGYSAELSSEGILDDRNEEKRVTEAEKNERVQRQLRTLTSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaacgtccgagttaccaccatggacgcggagctggagttcgccatc
cagccaaatacaacaggaaaacagcttttcgatcaggtggttaagaccatcggccttcgg
gaagtgtggtactttggcctccagtatgtagataataaaggatttcctacctggttgaaa
cttgataaaaaagtgtccgcccaggaggtcagaaaggagaaccctctgcagttcaagttc
cgggccaagttctaccccgaagacgtgtccgaggagctcatccaggacatcacccagaag
cttttcttcctgcaagtgaaggaggggattctcagcgatgagatttactgcccgcccgag
acggcggtgctcctgggctcctacgctgtgcaggccaagttcggggactacggcaaggag
ctgcacaagtccgggtaccttggctccgagcggctgatcccccaaagagtcatggaccag
cacaagctcaccagggaccagtgggaggaccggatccaggtgtggcacaccgagcaccgc
gggatgctcaaagacagtgctatgttggagtatctgaagattgcccaggacctggaaatg
tatgggatcaactattttgagataaaaaataagaaaggaacagacctttggcttggagtt
gatgcccttggactaaatatttatgagaaagatgataagttgaccccaaagattggcttc
ccatggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaagcccatc
gacaagaaggctcctgacttcgtgttctatgccccccgcctgcgaattaacaagcggatc
ctgcagctgtgcatggggaaccacgagctgtacatgcgccgcaggaagcccgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcagcagaagcagctggagcgg
cagcagctggaaaccgagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
gtgcgtgagaaggaagagctgatgctcaggctccaggactacgcggagaagaccaggaaa
gcggagaaagagctctcggaccagatccagcgagccctgaagctggaggaggagaggaag
cgggcgcaggaggagtccgagcgcctggaggccgagcgcctggccgcgctgcacgccaag
gacgagctggagaggcaggcggcggatcagatcaagagccaggagcagctggccacggaa
ctcgccgagtacactgccaagatcgccctcctggaggaggcgcggcggcgcaaggaggac
gaggtggaggagtggcagctccgggccaaagaagcccaggatgacctggtaaagaccaag
gaggagctgcacctggtgatgaccgcgcccccgccgcctccgcccccagtgtacgagccc
gttaactaccatgtccaggagaacccgcaggaggagggcacggagtaccccggctacagc
gccgagctgtccagtgagggcatcctggacgaccgcaacgaggagaagcgcgttaccgag
gccgagaagaacgagcgcgtgcagcggcagctgcggactctgaccagcgagctgtcccag
gccagagacgagaacaagcggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcgtcagatccgccagggcaacaccaagcagcgcatc
gacgagttcgaggccatgtga

DBGET integrated database retrieval system