KEGG   Delphinapterus leucas (beluga whale): 111167600
Entry
111167600         CDS       T05885                                 

Gene name
EGR2
Definition
(RefSeq) E3 SUMO-protein ligase EGR2
  KO
K12496  early growth response protein 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04625  C-type lectin receptor signaling pathway
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111167600 (EGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111167600 (EGR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111167600 (EGR2)
   05161 Hepatitis B
    111167600 (EGR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111167600 (EGR2)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    111167600 (EGR2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 Zf_RING zf-C2H2_8
Other DBs
NCBI-GeneID: 111167600
NCBI-ProteinID: XP_022416293
UniProt: A0A2Y9MGA1
LinkDB
Position
Unknown
AA seq 485 aa
MRVGLPSEASSCRWSARGPQDGPERRRSGPAHVLSDNIYPVEDLAATSVTIFPNAELGGP
FDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASC
YPEGIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCAMSQTQPDLDHLYSP
PPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPG
FFPSQCQRDLHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSAGATGPGASGG
SEGPRLPGSGSAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRF
SRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSD
ERKRHTKIHLRQKERKSGGPSSLVPAASTTSCTGGAQAGGTLCGSNSSTIGGGSLGPCSS
RTRTP
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgcgagtcgggctcccctccgaggcgtcgtcttgccggtggtcagcgcgggggccgcag
gacgggccggagcgcaggcggagtgggccggcgcacgtgctgtctgacaacatctacccg
gtggaggacctcgccgcgacgtcggtgaccatcttccccaatgccgaactgggaggcccc
tttgaccagatgaacggagtggccggagatggcatgatcaacattgacatgactggagag
aagaggtccttggatctcccatatcccagcagctttgctcctgtctctgcaccccgaaac
cagaccttcacttacatgggcaagttctccatcgacccccagtaccccggtgctagctgc
tacccagaaggcatcatcaacattgtgagtgcaggcatcctgcaaggggtcacctcccca
gcttccaccacagcctcatccagcgtcacctctgcctcccccaacccactggccactgga
cccttgggtgtgtgcgccatgtcccagacccagcctgacctggaccacctctactctcca
ccgccgcctcctccttattctggctgtgcaggagacctctaccaggacccctcggcgttc
ctgtcggcagccacaacctccacctcctcctctctggcctacccaccacctccttcctac
ccgtcccccaagccagccacggacccaggtctcttccccatgatcccagactatcctgga
tttttcccatcacagtgccagagagacctacatggtgcagctggcccagaccgcaagccc
tttccctgccccctggactccctgcgagtcccccctccactcactccactttccaccatc
cgcaactttaccctgggagggcccagtgctggggccacagggccaggggccagtggaggc
agcgagggaccccggctacctggcagcggctccgcagctgctgctgctgccgcctataac
ccacaccatctgccgctgcggcctattttgaggcctcgaaagtaccccaacaggcctagc
aagaccccagtgcatgagaggccctacccgtgcccagcagaaggctgtgaccggcgcttc
tcccgctccgacgagctaacacggcacatccgaatccacacggggcacaagcccttccag
tgtcggatctgcatgcgcaacttcagccgcagtgatcacctcactacccacatccgcacc
cacactggtgagaagccctttgcctgtgattactgtggccgcaagtttgcccggagtgat
gagaggaagcgccacaccaagatccacctgaggcagaaggaacgcaagagcggtggcccc
tcctcgttggtgccggccgcctccaccacctcctgcactgggggcgcgcaggctgggggc
accctgtgcggcagcaacagcagcactattggtggagggtccctcggcccttgctcatct
cggacccggacaccttga

KEGG   Delphinapterus leucas (beluga whale): 111169021
Entry
111169021         CDS       T05885                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X1
  KO
K12497  early growth response protein 3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04625  C-type lectin receptor signaling pathway
dle05161  Hepatitis B
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111169021 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111169021 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111169021 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111169021 (EGR3)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    111169021 (EGR3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6
Other DBs
NCBI-GeneID: 111169021
NCBI-ProteinID: XP_022418619
UniProt: A0A2Y9M8U7
LinkDB
Position
Unknown
AA seq 387 aa
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGEVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAAPVSLAPVVTTCA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttttctggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaacccggaactctcttattcgggctccttccagccagcccctggcaac
aagaccgtgacctacttgggaaagttcgcctttgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcctctggggcactc
agcacgcaaacctccacagccagcatggtgcagccgccgcagggggaagtggaggccatg
tatccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtgtctttc
cacgatccccagggcaaccccgggctcgcctattccccccaggattaccaatcggccaaa
ccggccttggacagcaatctcttccccatgattcctgactacaacctataccaccacccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aacccgccccctattacccccctggagaccatcaaggcattcaaagacaagcagatccac
ccgggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccccgcaag
taccccaaccgacccagcaagaccccgctacacgagcggccccacgcgtgcccggcggag
ggctgcgaccgccgtttcagccgctcggacgagctgacccggcatctgcgcatccacacg
ggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgaccacctt
accactcacatccgcacgcatacgggcgagaagccctttgcctgcgaattctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaaaatccacctcaagcaaaaggag
aagaaggcggagaaggggggtgcgccttctgcgtcctcggcggccccggtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system