KEGG   Delphinapterus leucas (beluga whale): 111167640
Entry
111167640         CDS       T05885                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111167640 (GADD45G)
   04064 NF-kappa B signaling pathway
    111167640 (GADD45G)
   04068 FoxO signaling pathway
    111167640 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111167640 (GADD45G)
   04210 Apoptosis
    111167640 (GADD45G)
   04115 p53 signaling pathway
    111167640 (GADD45G)
   04218 Cellular senescence
    111167640 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111167640 (GADD45G)
   05202 Transcriptional misregulation in cancer
    111167640 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111167640 (GADD45G)
   05212 Pancreatic cancer
    111167640 (GADD45G)
   05225 Hepatocellular carcinoma
    111167640 (GADD45G)
   05226 Gastric cancer
    111167640 (GADD45G)
   05214 Glioma
    111167640 (GADD45G)
   05216 Thyroid cancer
    111167640 (GADD45G)
   05220 Chronic myeloid leukemia
    111167640 (GADD45G)
   05217 Basal cell carcinoma
    111167640 (GADD45G)
   05218 Melanoma
    111167640 (GADD45G)
   05213 Endometrial cancer
    111167640 (GADD45G)
   05224 Breast cancer
    111167640 (GADD45G)
   05222 Small cell lung cancer
    111167640 (GADD45G)
   05223 Non-small cell lung cancer
    111167640 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111167640 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111167640 (GADD45G)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111167640 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111167640 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111167640
NCBI-ProteinID: XP_022416390
UniProt: A0A2Y9M3U0
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGTGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggacacggttcccgaaagcacggccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtctgcgcaacgccagggttgcctcacc
gccggcgtctacgagtcagccaaagttctgaacgtggaccccgacaacgtgactttctgc
gtgctggccgccgacgaggaggacgagggtgacatcgcgctgcagatccacttcactttg
atccaggcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagagg
ctggcggcgatcgtgggtaccggcgacgaggcgggtgcgccgggggacctgcactgcatc
ctcatttcgaaccccaacgaggatgcatggaaggaccccgccttggagaaactcagcctg
ttctgcgaggagagtcgcagcgtcaacgactgggtgcccaatatcaccctccccgagtga

KEGG   Delphinapterus leucas (beluga whale): 111170922
Entry
111170922         CDS       T05885                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111170922 (GADD45B)
   04064 NF-kappa B signaling pathway
    111170922 (GADD45B)
   04068 FoxO signaling pathway
    111170922 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111170922 (GADD45B)
   04210 Apoptosis
    111170922 (GADD45B)
   04115 p53 signaling pathway
    111170922 (GADD45B)
   04218 Cellular senescence
    111170922 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170922 (GADD45B)
   05202 Transcriptional misregulation in cancer
    111170922 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111170922 (GADD45B)
   05212 Pancreatic cancer
    111170922 (GADD45B)
   05225 Hepatocellular carcinoma
    111170922 (GADD45B)
   05226 Gastric cancer
    111170922 (GADD45B)
   05214 Glioma
    111170922 (GADD45B)
   05216 Thyroid cancer
    111170922 (GADD45B)
   05220 Chronic myeloid leukemia
    111170922 (GADD45B)
   05217 Basal cell carcinoma
    111170922 (GADD45B)
   05218 Melanoma
    111170922 (GADD45B)
   05213 Endometrial cancer
    111170922 (GADD45B)
   05224 Breast cancer
    111170922 (GADD45B)
   05222 Small cell lung cancer
    111170922 (GADD45B)
   05223 Non-small cell lung cancer
    111170922 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111170922 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111170922 (GADD45B)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111170922 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111170922 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111170922
NCBI-ProteinID: XP_022422249
UniProt: A0A2Y9MJA0
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRENNQWVPYIPLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacactggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgagc
gccgcggtggaggagctgctggtggctgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcctggct
attgacgaggaggaggaggacgacatcgctctgcagatccacttcacgctcatccagtcc
ttttgctgtgacaacgacattgacatcgtgcgggtgtcaggaatgcagcgcctggcacag
ctgctgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgcctc
ctggtcacgaaccctcacacagacgcctggaaaagccacggcctggtggaggttgccagt
tactgcgaagagagcagggagaacaaccagtgggtcccctacatccccctccaggagcgc
tga

KEGG   Delphinapterus leucas (beluga whale): 111178438
Entry
111178438         CDS       T05885                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05216  Thyroid cancer
dle05217  Basal cell carcinoma
dle05218  Melanoma
dle05220  Chronic myeloid leukemia
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111178438 (GADD45A)
   04064 NF-kappa B signaling pathway
    111178438 (GADD45A)
   04068 FoxO signaling pathway
    111178438 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111178438 (GADD45A)
   04210 Apoptosis
    111178438 (GADD45A)
   04115 p53 signaling pathway
    111178438 (GADD45A)
   04218 Cellular senescence
    111178438 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111178438 (GADD45A)
   05202 Transcriptional misregulation in cancer
    111178438 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111178438 (GADD45A)
   05212 Pancreatic cancer
    111178438 (GADD45A)
   05225 Hepatocellular carcinoma
    111178438 (GADD45A)
   05226 Gastric cancer
    111178438 (GADD45A)
   05214 Glioma
    111178438 (GADD45A)
   05216 Thyroid cancer
    111178438 (GADD45A)
   05220 Chronic myeloid leukemia
    111178438 (GADD45A)
   05217 Basal cell carcinoma
    111178438 (GADD45A)
   05218 Melanoma
    111178438 (GADD45A)
   05213 Endometrial cancer
    111178438 (GADD45A)
   05224 Breast cancer
    111178438 (GADD45A)
   05222 Small cell lung cancer
    111178438 (GADD45A)
   05223 Non-small cell lung cancer
    111178438 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111178438 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111178438 (GADD45A)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111178438 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111178438 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 111178438
NCBI-ProteinID: XP_022436840
UniProt: A0A2Y9NS28
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLESDAGPALSEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgaccccgataacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggacgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcgacatcctgcgcgtcagcaaccctggccggctggccgag
ctcctgctcctggagagtgacgcgggccccgcgttgagcgagggcgcggagcagcccccg
gacttgcactgcgtgctggtgacgaatccacattcatcacagtggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system