KEGG   Delphinapterus leucas (beluga whale): 111167662
Entry
111167662         CDS       T05885                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X1
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04064  NF-kappa B signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04380  Osteoclast differentiation
dle04611  Platelet activation
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle05152  Tuberculosis
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05171  Coronavirus disease - COVID-19
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111167662 (SYK)
   04072 Phospholipase D signaling pathway
    111167662 (SYK)
   04151 PI3K-Akt signaling pathway
    111167662 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111167662 (SYK)
   04625 C-type lectin receptor signaling pathway
    111167662 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    111167662 (SYK)
   04662 B cell receptor signaling pathway
    111167662 (SYK)
   04664 Fc epsilon RI signaling pathway
    111167662 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    111167662 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111167662 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111167662 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111167662 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111167662 (SYK)
   05168 Herpes simplex virus 1 infection
    111167662 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111167662 (SYK)
   05169 Epstein-Barr virus infection
    111167662 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111167662 (SYK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111167662 (SYK)
Protein kinases [BR:dle01001]
 Non-receptor tyrosine kinases
  SYK family
   111167662 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 111167662
NCBI-ProteinID: XP_022416417
UniProt: A0A2Y9MGM5
LinkDB
Position
Unknown
AA seq 626 aa
MGDSANHLPFFFGNITREEAEDYLAQGGMSDGLYLLRQSRNYLGGFALSVAHDRKAHHYT
IERELNGTYAISGGRAHSSPAELCHYHSQELDGLICLLKKPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRSRDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKFDGQMGNINFRPQLPSSHPVTWSAGGIISRIKSYSFPKPGHRKGS
SSQRPESLVTFNPYEPDRGPWANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDRKL
LTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNETNDPALKDELLAEANVMQQLDN
PYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECN
FVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKF
SSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCW
TYDVENRPGFVAVELRLRNYYYDVVN
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgggtgacagcgctaaccacctgcccttcttcttcggcaacatcacccgggaggaggca
gaagactacctggcccaggggggcatgagcgacgggctctacctgctgcgccagagccgc
aactacctgggcggcttcgccctgtcagtggcgcacgaccggaaggcacatcactacacc
attgagcgggagctaaacggaacctacgccatctcgggcggcagggcccacagcagcccc
gccgagctttgccactaccactcccaggagctggatggcctcatctgcctcctcaagaag
ccctttaaccggccgcccggggtgcagcccaaaaccggcccctttgaggacctgaaggag
aacctcatccgggagtatgtgaaacagacatggaacctacagggtcaagctctcgagcag
gccattatcagccagaaacctcagctggagaagctgatcgccaccacagcccatgaaaaa
atgccctggttccacggaaaaatctctcgggatgaatctgagcagattgtcctgatagga
tcaaagacaaatggaaagtttttgatcaggtccagggacaacgggtcttacgccctgtgc
ctgctgcacgaggggaaggtgctgcactaccgcatcgataaggacaaaacggggaagctc
tccatccctggcgggaagaatttcgacacactatggcagctcgtcgagcattattcttat
aagtcagatggtttgttaagagttcttacagttccatgtcaaaaatttgatgggcaaatg
ggaaatattaatttccgtccacaacttccaagttcccatcccgtgacttggtcagcgggt
ggaataatctcaagaatcaaatcatactccttcccaaagcctggccacagaaagggctcc
tcatcccaaaggccagaaagtttggtgacgttcaacccttatgagccagaccgagggccc
tgggccaacgaaagagaagcccagagagaagccttgcccatggacaccgaggtctatgaa
agcccctatgcagaccccgaggagatcaggcccaaagaggtctacctggaccggaagctg
ctgaccctggaggacaaggaactgggctctgggaactttgggacggtgaagaagggctac
taccagatgaaaaaagttgtgaaaacagtggctgtgaaaatcctgaaaaacgagaccaat
gaccccgctcttaaagatgagttattagcagaagcaaacgtcatgcagcaacttgacaac
ccttacattgtgcgcatgattgggatatgcgaagccgagtcctggatgctggttatggag
atggcggaacttggtccactcaacaaatatttacagcagaacaggcatgtcaaggataag
aacatcatagagctggttcatcaggtgtctatgggaatgaagtatttggaagagtgcaat
tttgtgcacagagatctggctgcaagaaatgtattgctggttactcaacattatgccaag
atcagtgattttggactttccaaagcacttcgtgctgatgaaaactactacaaggcccag
acccacgggaagtggcccgtgaagtggtacgctccggaatgcatcaactactacaagttc
tccagcaagagtgacgtctggagctttggagtgttaatgtgggaagcattttcctacggg
cagaagccgtatcggggaatgaaaggcagcgaagtttctgctatgctggagaaaggagag
aggatggggtgccctccagggtgtccgagagagatgtacgagctgatgaccctgtgctgg
acctatgacgtggagaacaggcccggatttgtagcagtggaactgcggctgcgcaattac
tactacgatgtggttaactaa

DBGET integrated database retrieval system