KEGG   Delphinapterus leucas (beluga whale): 111167700
Entry
111167700         CDS       T05885                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04218  Cellular senescence
dle04620  Toll-like receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04714  Thermogenesis
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05145  Toxoplasmosis
dle05161  Hepatitis B
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111167700 (MAP2K3)
   04015 Rap1 signaling pathway
    111167700 (MAP2K3)
   04668 TNF signaling pathway
    111167700 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111167700 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111167700 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    111167700 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111167700 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    111167700 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111167700 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    111167700 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111167700 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111167700 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    111167700 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111167700 (MAP2K3)
   05135 Yersinia infection
    111167700 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111167700 (MAP2K3)
   05161 Hepatitis B
    111167700 (MAP2K3)
   05169 Epstein-Barr virus infection
    111167700 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111167700 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111167700 (MAP2K3)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111167700 (MAP2K3)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111167700 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1
Other DBs
NCBI-GeneID: 111167700
NCBI-ProteinID: XP_022416552
UniProt: A0A2Y9MBS5
LinkDB
Position
Unknown
AA seq 347 aa
MESPAASQPAGVPASKGKSRRKKDLRISCVSKPPAPSPTPPRNLDSRAFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKDMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaatctcctgccgcgagccagcccgccggtgtgcccgcatccaaaggaaagtccagg
aggaagaaggatttacgaatctcctgcgtgtccaagccgccggcgcccagccccacgccc
ccccggaacctggactcccgggccttcatcaccatcggggacaggaactttgaggtggag
gcagatgacctggtgaccatctcggagctgggccgaggcgcctacggggtagtggagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcgcatccgtgccaccgtgaac
tcgcaggagcagaagcgcctgctcatggatttggacgtgaacatgcgcacggtcgactgc
ttctacaccgtcacattctacggggccctcttcagagagggagatgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggacaaggacatgacg
atcccagaggacattctcggggaaatcgctgtatctattgtgagggccctggagcacctg
cacagcaagctgtccgtgatccacagagacgtgaagccgtccaacgtgctcatcaacaag
gagggccacgtgaagatgtgcgactttgggatcagtggctacctggtggattccgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagagaatcaacccggagctg
aaccagaaaggctacaatgtcaagtccgacgtctggagcctcggcatcaccatgatcgag
atggccatcctgcggtttccttatgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccgcagctcccagctgaccgcttctcccccgagtttgtggac
ttcactgcacagtgcctgagaaagaaccctgcggaacgcatgagctacctggagctgatg
gaacaccctttcttcacctcgcacaaaaccaagaagaccgacatcgctgcctttgtgaag
gagatcctgggagaggactcgtag

KEGG   Delphinapterus leucas (beluga whale): 111182897
Entry
111182897         CDS       T05885                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04015  Rap1 signaling pathway
dle04218  Cellular senescence
dle04380  Osteoclast differentiation
dle04620  Toll-like receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05014  Amyotrophic lateral sclerosis
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05145  Toxoplasmosis
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111182897 (MAP2K6)
   04015 Rap1 signaling pathway
    111182897 (MAP2K6)
   04668 TNF signaling pathway
    111182897 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111182897 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111182897 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    111182897 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111182897 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    111182897 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111182897 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111182897 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111182897 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111182897 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    111182897 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111182897 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111182897 (MAP2K6)
   05135 Yersinia infection
    111182897 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111182897 (MAP2K6)
   05161 Hepatitis B
    111182897 (MAP2K6)
   05163 Human cytomegalovirus infection
    111182897 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111182897 (MAP2K6)
   05169 Epstein-Barr virus infection
    111182897 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111182897 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111182897 (MAP2K6)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111182897 (MAP2K6)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: STE group
  STE7 family
   111182897 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 111182897
NCBI-ProteinID: XP_022445485
UniProt: A0A2Y9PI64
LinkDB
Position
Unknown
AA seq 368 aa
MAATAGHCSFHSSLCAASVFSAQQHPDCRPLWLTSLASPGKKRNPGLKIPKEAFEQPQTS
STPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRA
TVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDK
GQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVD
SVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQ
LKQVVEEPSPQLPADKFSEEFADFTSQCLKKNSKERPTYPELMQHPFFTLHESKATDVAS
FVKSILGD
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcagccaccgctggccactgctctttccactcctctttgtgtgctgcttctgttttt
tccgctcagcagcatcccgactgtcggcccctgtggcttacttctttagcatctccaggc
aagaagagaaaccctggccttaaaatcccaaaagaagcatttgaacaacctcagaccagt
tccacgccacctcgagatttagactccaaagcttgcatttctattggaaatcagaacttt
gaggtgaaggcggatgacctggagcctatagtggagctgggccggggggcgtacggggtg
gtggagaagatgcggcatgtgcccagcgggcagatcatggcggtgaagcggatccgggcc
acagtaaatagccaggagcagaaaaggttactgatggatttggatatttccatgaggacc
gtggactgtccttttacggtcaccttttatggcgcactcttccgtgagggggatgtctgg
atctgcatggagctcatggacacgtccctagataaattctacaaacaagtgattgataaa
ggccaaacaattccagaggacatcttagggaaaatagcagtttctattgtaaaagcatta
gaacatttacacagtaagctctctgtcattcatcgagatgtcaagccttccaatgtgctc
atcaacaccctgggccaggtgaagatgtgcgattttggaatcagcggctaccttgttgac
tccgtcgctaaaactatcgatgcaggatgcaaaccgtacatggcccccgagagaataaac
ccagagctcaaccagaagggatacagcgtgaagtccgacatttggagtctgggcatcacc
atgatcgagctggccatcctccggtttccctatgattcgtggggaactccttttcagcag
ctcaaacaggtggtggaggagccgtcgccacaactcccggcagacaagttctccgaagag
tttgctgactttacctcacagtgcttgaagaagaattccaaagagaggccaacatatcca
gagcttatgcaacatccatttttcaccctacacgaatccaaagcgacagacgtggcatct
tttgtaaaatcgattcttggagactaa

DBGET integrated database retrieval system