KEGG   Delphinapterus leucas (beluga whale): 111167742
Entry
111167742         CDS       T05885                                 

Gene name
NCOR1
Definition
(RefSeq) nuclear receptor corepressor 1 isoform X1
  KO
K04650  nuclear receptor co-repressor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04919  Thyroid hormone signaling pathway
dle05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111167742 (NCOR1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111167742 (NCOR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111167742 (NCOR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111167742 (NCOR1)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111167742 (NCOR1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 111167742
NCBI-ProteinID: XP_022416609
UniProt: A0A2Y9M4G4
LinkDB
Position
Unknown
AA seq 2454 aa
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPSTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRAGYEQFHPGPSPADHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHTLPEGVRSSADAKKDSAFGVKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTGVPARRMMKNQVMRKKLIL
FFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRK
QREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAE
QRRVKFINMNGLMEDPMKIYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSV
PDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEE
EKKDEEEKDEKEDSKENTKEKDKTESTAEETEEREQATPRGRKTANSQGRRKGRVTRSMT
SEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAI
AKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQE
DEDIEASNEEENPEDSEGAENSSGTESAPSPSPVEAVKPGEDSTENAPPRGTTPDPVPRA
SPSPAVPSTEAAEDASVETQANDSVAVDTAEPMDVGHRECGAEGTSALDLPSATKADAAD
VEMPESSPSRVEGDPKDRDLERGSEKPEPGGDDLGVAQQMSAPRPELPSDHDSSATCSAD
EDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPIKPNPLDLPQLQHRAAVIPPMVSCTPC
NIPIGTPVSGFALYQRHIKAMHESALLEEQRQRQEQMDLERRGSASPRGAPKSPNREWEV
LQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFILGGSISQGTPGTYL
PSPNQASYAPEAAKPSAGSISLGLPRQQEAAKPATVPYIKQEEFSPRSQNSQPEGLLVRA
QHEGVVRGTTGAIQEGSITRGTPSSKLSVESIPSLRGSITQGTPALSQAGIPTEALVKGP
ISRLSIEESSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRS
YESVEGALKQGLSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTE
SFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDVLTQESQK
TPEVVQSTRPMVEGSISQGTPVKSDSSSGQSAIKHNVKSLVAGPSRLPRGLPPLEIRPES
IKAVERGKYEDVKAGEPVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYEDTSARRTPG
SYASTAPRGSPMMSRAPDVTISSSKSTSHERKSTLTPTQRESITAKSPVPGVDPAVSHSP
FEPHHRGGAPGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPPPGYPSQYQLYAM
ENTRQTILNDYITSQQMQVGLRPDVARGLSPREQQLGLPYPATRGIIDLTNMPPAILVPH
PGGTSTPPMDRITYIPGTQVTFPPRPYNSASMSPGHSTHLAAAANAEREREREKERERLT
AAPSDLCLRPGSEQPGRPSSHGYVRSPSPSVRAQETLLQQRPSVFQGTNGTSVITPLDPS
AQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLE
ENLRSRSAAVSEQQLEQKSLEAEKRPGQCLYTSSALPSGKPQPHSAVVYSEAGKEKGPPP
KSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSGSLSSHRYETPGD
AIEVISPASSPAPPPERLQAYQPEVVKASQAENEACRQYEGPLHHYRPQPESPSPQPPPP
PSSQAEGVGQVPRTHRLITLADHICQIITQDFARNQVPSQPPQQPPTSTFQNSPSALVST
PVRTKTSNRYSPESQSQSLHHQRPGSRVSPENLVDKSRGSIRPGKSPERSHVSSEPYEPI
SPPQVPVVHEKQDSVLLLAQRGSEPAEQRNDSRSPGSISYLPSFFTKLENTSPMVKSKKQ
EIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKA
LMGSFEDKVEDHGVAMPQPLGGVPGGAGTSVATSGEARREEGDPSPHSGGVCKPKLISKS
NSRKSKSPIPGQGYLGAERPSSASSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTM
RMLSSTPPAPVACAPVACAPASASPAAPHQPSRIWDREPAPLLSAQYETLSDSD
NT seq 7365 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttatcctcccaaccaaggagcattcagcacagagcaaagtcgttat
cctccccactctgttcagtacacctttcccagcacccgtcaccagcaggagtttgcagtc
cctgattatcgttcttctcatctcgaagtcagtcaggcctcacagctcttgcagcaacag
cagcagcagcagcttcgcagacgaccttccctgctttcagagtttcacccaggttctgac
aggcctcaagaaaggagagctggatatgagcagtttcacccaggcccttccccggcggat
catgattcactggaatccaagcgaccacgtctggagcaggtttctgattcccatttccag
cgggtcagcgctgcggtcttacctttagtgcacacgctgccagaaggggtgaggtcttct
gcagatgctaagaaggattcagcatttggagtcaaacatgaagctccttcctctccaatc
tctgggcaaccatgtggagatgatcaaaatgcttcaccttcaaaactttcaaaggaagag
ttaatacagagtatggatcgtgtagatcgagaaattgcaaaagtagaacagcagatcctt
aaactgaaaaagaaacaacaacagctcgaagaagaagctgctaaacctccagagcctgag
aagcctgtgtcacctcctcccgtggagcagaaacaccgcagtattgtccagattatttac
gatgaaaatcggaaaaaagcagaagaagctcataaaatatttgaaggtcttggcccaaaa
gttgaactgccactctataaccagccatcagataccaaagtgtatcatgagaacatcaag
actggagtacctgcaaggcgcatgatgaaaaaccaggtgatgaggaaaaaactcatttta
ttttttaaaagaagaaatcatgcaagaaaacaaagggagcaaaaaatctgccaacgttat
gatcagctcatggaggcatgggagaaaaaagtggacagaatagaaaataatcctcggagg
aaagctaaagaaagcaaaacaagggagtattatgaaaagcagtttccagaaattcgaaaa
caaagagaacagcaagaacggtttcagcgagttgggcagaggggagctggtctttcagcc
accattgctaggagtgaacatgagatttctgaaattattgatgggctctctgaacaggag
aataatgagaaacaaatgcgacagctctctgtgatcccacctatgatgtttgatgcagaa
cagagaagggtcaagttcattaacatgaatgggcttatggaggaccctatgaagatttat
aaagataggcagttcatgaatgtttggactgaccatgagaaggagatctttaaggacaag
tttatccagcatccaaaaaactttggactaattgcatcttacttggaaaggaagagtgtt
cctgattgtgttttatattactacttaaccaagaaaaatgagaattataaagccctagta
agaaggaactatggaaaacgcagaggaagaaaccagcagcaaattgcccgaccctcacaa
gaagaaaaagtagaagaaaaagaagaagataaagcagaaaaaacagaaaaaaaagaggag
gaaaagaaagatgaagaagaaaaagatgaaaaggaggactctaaagaaaacaccaaggaa
aaggataagacagaaagtacagcagaagaaactgaggagagagagcaggccacgccccgg
ggccgaaagactgccaacagtcagggccgccgaaagggccgggtcaccaggtccatgacc
agtgaggccgcagctgccagcgctgcagctgctgcagccaccgaggagccccccccacct
ctgccaccgccgccggaacccatttctacagaacctgtagaaacctctcgatggacagaa
gaagaaatggaagttgctaaaaaaggtctcgtagaacatggtcgtaactgggcagcaatt
gccaaaatggtgggaactaaaagtgaagcccaatgtaaaaacttctattttaactataag
agacgacacaatcttgacaacctcttgcagcagcataaacagaaagcctcacggaagcct
cgtgaagagcgagatgtgtctcagtgtgaaagtgtagcttccaccgtttctgctcaggag
gacgaggacatcgaagcctccaacgaagaggaaaatcccgaggacagtgaaggtgctgaa
aatagttctggtacagaaagtgctccttctccttcaccagttgaagctgtcaagcccggc
gaagacagcactgaaaacgcgcctcctcgggggaccacgcccgaccccgtgcccagggcc
tctccgtcgccggcagttccgagcacagaagcagccgaggatgccagtgtggagacccag
gcgaacgacagcgtggcagtggacacagcagagccgatggacgtggggcacagggagtgc
ggggctgaaggcacttctgctctggacctcccctcggccaccaaggctgatgctgcggac
gtggaaatgccagaaagcagtccatccagagtcgaaggggaccccaaagacagagacctg
gagagaggcagcgagaagccggagcctggaggcgacgacctaggggtggcccagcagatg
agcgccccgaggcccgagctcccctctgaccacgactccagtgccacgtgcagtgccgat
gaggatgtggacggggaacccgagaggcagcgaatgtttcctatggattcaaagccttca
ttgttaaaccccactggatctatactggtctcgtccccaataaaaccaaatccactggac
ctgccacagcttcagcatcgagctgctgtcatcccgccaatggtttcctgcaccccatgt
aacataccgattggaactccagtgagcggcttcgccctctaccagcgacacatcaaagcc
atgcatgagtcagcgcttctggaggagcagcggcagaggcaggagcagatggacctggag
cgcaggggttctgcgagcccacgtggcgcccccaagagcccaaacagagagtgggaagtc
ctccagcctgctccgcatcaagtgataactaacctccctgaaggggttcggcttccaaca
actcgacccactaggccacctcctcctctcatcccatcatccaaaaccacagtggcttca
gaaaaaccatcttttatactgggaggctccatctcacagggaacacccggcacttacttg
ccttctcctaatcaggcctcctatgctcctgaggcagcgaagccctcggcgggctccatc
tccctgggactgccgcggcagcaggaggccgccaagccagctactgtgccctacatcaag
caagaagagttttctccccgaagccaaaactcacaacctgagggtttattggtcagagcc
caacatgaaggagtggtcagaggtaccacaggagccattcaagaaggaagtataactcgg
ggaactccctccagcaaactttctgtggagagcatcccatccctccggggctctatcacc
caggggaccccggctctgtcccaggctggcataccaactgaggctttggtgaagggaccc
atttctagactgtccattgaagagagcagtcctgagaaaggccgagaggaagctgcatcc
aaaggccatgttatttatgaaggcaaaagtggacacatcttatcttacgataatattaag
aatgcccgagaagggacgaggagtccgagaacagctcatgaaatcagtctcaaaagaagc
tatgaatcagtggaaggagctctaaagcaagggttgtccatgagggagtctcctgtgtca
gcaccgctggaggggctgatctgccgagcattacccagggggagccctcactctgacctc
aaagaaagaactgtgctgtctggttccataatgcagggcacaccaagagcgacaactgaa
agttttgaagatggccttaagtaccccaaacagattaaaagggagagtccgcccatacga
gcgtttgaaggtgccattaccaaaggaaaaccttacgatggcatcaccaccatcaaagag
atggggcgctccatccatgagatcccacggcaagatgttttaactcaggaaagccagaaa
accccagaagtggtacagagcacgaggcccatggtcgagggctccatctcccagggcaca
cccgtcaagtctgacagcagttcaggccaatccgccatcaagcacaacgtcaagtccttg
gtcgcggggcctagcagactgccccgtgggctgcctccactggaaattaggccagagagc
ataaaagcggtcgaacggggaaaatacgaggacgtgaaagcaggcgagcctgtgcgttcc
cggcacacgtcggtggtaagctctggcccctcggttctcaggtcaacgcttcacgaagcc
cccaaagcacagctgagcccggggatttacgaggacaccagcgcacggcggacgccgggg
agttacgccagcactgcgcccagaggctcgcccatgatgagcagagctcccgatgttacg
atttcttctagcaagtctaccagtcatgaaaggaaatcgacactgacccctacccagagg
gaaagcatcacagcgaagtctccagttcctggggtagaccctgcagtgagccacagccct
tttgagccgcaccacaggggcggtgccccaggggaggtttaccggagccatctgcccaca
catctggacccagccatgccgtttcaccgggctctggatcctgcagctgccgcttacctg
ttccagaggcagctgtccccacccccaggctacccaagtcagtaccagctctacgcgatg
gagaacacgcggcagaccatcctcaacgactacatcacctcgcagcagatgcaagtgggc
ctgcgcccggacgtggccagagggctgtccccccgcgagcagcagctgggtcttccgtac
ccagcaaccaggggaatcattgacctgaccaatatgcccccagcaattttagtgcctcat
ccagggggaacaagcactccccccatggacagaatcacttacattcctggaacacaggtc
accttccctccgcggccgtacaactctgcgtccatgtctccaggacactcaacacacctc
gcggctgcggcaaacgctgaaagagagcgggagcgggagaaggagcgggagcgcctcacc
gcagccccctcggacctctgcctgcggccaggctcagaacagcccggccggcccagcagc
cacggctatgttcgctccccgtctccttcagtcagagctcaggagaccctgctgcagcag
agacccagcgttttccagggaaccaacggaaccagcgtgatcacacctttggacccgagc
gcacagctacggatcatgccgctgcctgctgggggcccttccatcagccagggcctgccg
gcctcccgttacaatactgctgcggacgccctggctgctcttgtggacgccgcagcgtct
gctccccagatggacgtgtccaaaacaaaagagagtaagcatgaagctgccaggttagaa
gaaaatttgaggagcaggtcagcagcagttagtgagcagcagctagagcagaaaagcctg
gaggcggagaagagacccggtcagtgtctgtacacttcttcagccctgccgagtggcaag
ccccagcctcattctgcagtagtttactctgaggctgggaaagagaaagggcctcctcca
aaatccagatatgaggaagagctaaggacccgagggaagactaccattaccgcagctaac
ttcatagacgtgatcatcacccggcaaattgcctcggacaaggatgcaagggaacgtggc
tcccagagttcagactcttccggtagcttatcttctcaccggtatgaaacacctggcgat
gccattgaggtgataagccctgccagctcccccgcgccgccccccgagaggctgcaggcc
taccagccggaggtcgtgaaggcgagccaggcagaaaacgaagcctgcaggcagtacgaa
ggaccgctgcaccactatcggccgcagccggagtcgccctccccgcagccgccgccgccc
ccatcgtcacaggccgagggggtggggcaggtgcccaggacacaccgactcatcacactt
gctgatcacatctgtcaaattatcacgcaagattttgctagaaatcaagttccgtcacag
cctccccagcagcctcccacttctacattccaaaattcaccgtctgctttggtgtctaca
cccgtgaggactaaaacatcaaaccgttatagcccagaatcccagtctcagtctcttcac
catcaaagaccaggttcaagggtctctccagaaaatcttgtggacaaatccaggggaagt
atcaggcctggaaagtccccagagaggagtcacgtctctagcgagccctacgagcccatc
tccccaccccaggttccggtcgtgcacgagaaacaggacagcgtgctgctcctggcccag
cgcggatccgagcccgcagagcagaggaatgattcccgatcaccagggagtataagctac
ttgccttcattcttcaccaagctggaaaacacctcacccatggttaaatcaaagaagcag
gagatctttcgtaagttgaactcctctggtggaggtgactctgatatggcagctgctcag
ccaggaactgagatctttaacctgccagcagtcaccacctcaggctccgtgagctcccga
ggtcattcctttgctgaccctgccagcaacctcgggctggaggacatcatccggaaggcg
ctcatggggagctttgaagacaaagtggaggaccacggggtcgccatgccccagcccctg
gggggggtgcctggtggtgccggcacctcggtggcgaccagcggtgaggcccggagagag
gaaggggacccgtcacctcattcaggaggagtttgcaaaccaaagctgatcagcaagtca
aacagcaggaagtcgaaatctcctatcccggggcaaggctacttgggagctgaacggccc
tcctcagcctcctctgtgcactcggaaggggactaccacaggcagacgccaggctgggcc
tgggaggacaggccttcctccacaggctcgacgcagttcccctacaaccccctgaccatg
cggatgctcagcagcacgccccctgcgcccgtcgcctgtgcgcccgtcgcctgtgcgccc
gcctctgccagccccgccgcccctcaccagccgagcaggatctgggatcgggagccggcc
ccgctgctctccgcgcagtatgagacgctgtccgacagcgactga

DBGET integrated database retrieval system