KEGG   Delphinapterus leucas (beluga whale): 111167945
Entry
111167945         CDS       T05885                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04915  Estrogen signaling pathway
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05223  Non-small cell lung cancer
dle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111167945 (TGFA)
   04012 ErbB signaling pathway
    111167945 (TGFA)
   04014 Ras signaling pathway
    111167945 (TGFA)
   04151 PI3K-Akt signaling pathway
    111167945 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111167945 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111167945 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111167945 (TGFA)
   05212 Pancreatic cancer
    111167945 (TGFA)
   05225 Hepatocellular carcinoma
    111167945 (TGFA)
   05214 Glioma
    111167945 (TGFA)
   05211 Renal cell carcinoma
    111167945 (TGFA)
   05215 Prostate cancer
    111167945 (TGFA)
   05223 Non-small cell lung cancer
    111167945 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111167945 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 111167945
NCBI-ProteinID: XP_022417054
UniProt: A0A2Y9M4R3
LinkDB
Position
Unknown
AA seq 176 aa
MVTSAGQLALFVLGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPASHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALTVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGKRAASRKGLFPSGDTIG
NT seq 531 nt   +upstreamnt  +downstreamnt
atggttacctcggctggacagctcgccctcttcgtgctgggtcttttgttggctgtgtgc
caggccctggagaacagtacgtccgctctgagtgcagacccgcccgtggccgcagctgtg
gtgtcccattttaatgactgccctgcttcccacagtcaattctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcggacctcctggccgtggtggccgccagccagaagaagcaggccatt
actgccttggtggtggtctccatcgtggccctgactgtccttatcatcacgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgaatggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacaggtaag
agggctgcctcaaggaaaggcctttttccctcgggagacactattgggtag

DBGET integrated database retrieval system