KEGG   Delphinapterus leucas (beluga whale): 111168033
Entry
111168033         CDS       T05885                                 

Gene name
RDX
Definition
(RefSeq) radixin isoform X1
  KO
K05762  radixin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04530  Tight junction
dle04810  Regulation of actin cytoskeleton
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111168033 (RDX)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111168033 (RDX)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111168033 (RDX)
   05205 Proteoglycans in cancer
    111168033 (RDX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111168033 (RDX)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111168033 (RDX)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 111168033
NCBI-ProteinID: XP_022417244
UniProt: A0A2Y9M586
LinkDB
Position
Unknown
AA seq 583 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDFNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTLK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNDGVMNHRSEEERITEMQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtaagagtaacaacaatggatgctgagctggaatttgccatt
cagcccaacacaactggcaaacagctttttgaccaggtggtgaaaacggttggtttgcgt
gaagtctggttttttgggctgcagtatgtggacagcaagggctattctacgtggcttaaa
ctaaataaaaaggtgacacagcaagatgttaaaaaagagaatcctttgcagttcaaattt
agagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagaga
cttttcttcttgcaagttaaagaagctatcttaaatgatgagatatattgtccaccagaa
actgcagttcttttggcttcctatgctgtccaagccaagtatggagattttaataaagag
attcataagccaggctacctggctaatgatagactcctaccccagcgtgttttggaacaa
cacaaactgacaaaagaacagtgggaagaaagaatacagaactggcatgaagaacataga
ggaatgctaagggaagattctatgatggaatacctgaagattgcacaggatctagaaatg
tatggagtcaactattttgaaataaaaaataaaaagggaactgaattgtggctaggtgtt
gatgctttgggtctgaatatttatgaacatgatgacaagttaacacctaaaattggtttt
ccctggagtgaaatcagaaatatttcatttaatgacaaaaaatttgttataaagccgatt
gacaaaaaggctcctgattttgttttttatgcacctcgtctgaggatcaataagcggatt
ttggccttatgcatgggaaaccatgaactatacatgcgaagaaggaagcctgatactatt
gaggtacaacagatgaaggctcaggctagggaggagaaacatcagaagcagttggaaagg
gcgcaattagagaatgaaaagaagaaaagagaaatagcagaaaaggaaaaggaaagaata
gaacgtgaaaaggaagagctaatggaacgtctgaggcaaattgaagaacagacattgaaa
gcccagaaagaactagaagaacagactcgaaaagctctagaactggaccaggaacgaaaa
cgagcaaaagaagaagcagaaaggcttgaaaaggagcgtcgagctgctgaagaggccaaa
tctgctatagcaaaacaggctgccgaccagatgaagaatcaggagcagctggcagcagaa
cttgccgaattcactgccaagattgcgcttctagaagaagccaagaaaaaaaaggaggag
gaagctactgagtggcaacacaaagcttttgcagcccaggaagacttggaaaagaccaaa
gaagagttaaagactgtgatgtctgcccctcctccacctccaccaccaccagtcattcct
ccaacagaaaatgaacatgatgaacatgatgagaataatgctgaggctagtgctgaatta
tcaaatgacggggtaatgaaccatagaagtgaggaggaacgtataacagaaatgcaaaaa
aatgagcgtgttaaaaaacaactccaggcattaagttcagaattagcccaagccagagat
gaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgat
aagtacaagactctgcgacagattcggcaaggcaatacaaagcaacgtattgatgagttt
gaagcaatgtga

DBGET integrated database retrieval system