KEGG   Delphinapterus leucas (beluga whale): 111168040
Entry
111168040         CDS       T05885                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04012  ErbB signaling pathway
dle04062  Chemokine signaling pathway
dle04110  Cell cycle
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04310  Wnt signaling pathway
dle04340  Hedgehog signaling pathway
dle04360  Axon guidance
dle04390  Hippo signaling pathway
dle04510  Focal adhesion
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04657  IL-17 signaling pathway
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04722  Neurotrophin signaling pathway
dle04728  Dopaminergic synapse
dle04910  Insulin signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05135  Yersinia infection
dle05160  Hepatitis C
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05213  Endometrial cancer
dle05215  Prostate cancer
dle05217  Basal cell carcinoma
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111168040 (GSK3B)
   04310 Wnt signaling pathway
    111168040 (GSK3B)
   04340 Hedgehog signaling pathway
    111168040 (GSK3B)
   04390 Hippo signaling pathway
    111168040 (GSK3B)
   04151 PI3K-Akt signaling pathway
    111168040 (GSK3B)
   04150 mTOR signaling pathway
    111168040 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111168040 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168040 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    111168040 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111168040 (GSK3B)
   04657 IL-17 signaling pathway
    111168040 (GSK3B)
   04662 B cell receptor signaling pathway
    111168040 (GSK3B)
   04062 Chemokine signaling pathway
    111168040 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111168040 (GSK3B)
   04917 Prolactin signaling pathway
    111168040 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    111168040 (GSK3B)
   04919 Thyroid hormone signaling pathway
    111168040 (GSK3B)
   04916 Melanogenesis
    111168040 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    111168040 (GSK3B)
   04722 Neurotrophin signaling pathway
    111168040 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    111168040 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168040 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111168040 (GSK3B)
   05225 Hepatocellular carcinoma
    111168040 (GSK3B)
   05226 Gastric cancer
    111168040 (GSK3B)
   05217 Basal cell carcinoma
    111168040 (GSK3B)
   05215 Prostate cancer
    111168040 (GSK3B)
   05213 Endometrial cancer
    111168040 (GSK3B)
   05224 Breast cancer
    111168040 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111168040 (GSK3B)
   05020 Prion disease
    111168040 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    111168040 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111168040 (GSK3B)
   04931 Insulin resistance
    111168040 (GSK3B)
   04934 Cushing syndrome
    111168040 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111168040 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    111168040 (GSK3B)
   05162 Measles
    111168040 (GSK3B)
   05163 Human cytomegalovirus infection
    111168040 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111168040 (GSK3B)
   05165 Human papillomavirus infection
    111168040 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111168040 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111168040 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111168040 (GSK3B)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     111168040 (GSK3B)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   111168040 (GSK3B)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111168040 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 111168040
NCBI-ProteinID: XP_022417312
UniProt: A0A2Y9ME39
LinkDB
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattgggaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagag
ctggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgttaagttg
tatatgtatcagctattccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacaaccaatatttccaggggac
agtggtgtggatcaattggtagaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagttcgggtcttccgacct
cgaactccaccagaggcgattgcactatgtagccgtctgctggaatataccccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaaccccttcaaataccacagcagcctcagatgctaatgctggagaccgtggacag
accaataacgccgcttccgcatcagcttccaactccacctga

DBGET integrated database retrieval system