KEGG   Delphinapterus leucas (beluga whale): 111168050
Entry
111168050         CDS       T05885                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle03440  Homologous recombination
dle04064  NF-kappa B signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111168050 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111168050 (ATM)
   04068 FoxO signaling pathway
    111168050 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111168050 (ATM)
   04210 Apoptosis
    111168050 (ATM)
   04115 p53 signaling pathway
    111168050 (ATM)
   04218 Cellular senescence
    111168050 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111168050 (ATM)
   05206 MicroRNAs in cancer
    111168050 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111168050 (ATM)
   05170 Human immunodeficiency virus 1 infection
    111168050 (ATM)
   05165 Human papillomavirus infection
    111168050 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111168050 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111168050 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dle03032]
    111168050 (ATM)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111168050 (ATM)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111168050 (ATM)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111168050 (ATM)
DNA replication proteins [BR:dle03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111168050 (ATM)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111168050 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 111168050
NCBI-ProteinID: XP_022417290
UniProt: A0A2Y9M6F8
LinkDB
Position
Unknown
AA seq 3064 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIQDPETVQHLDQHSDSKQGKYLNWDAV
FRVLQKYIQKETECLRTAKPNVSTSTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMETVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWTELFSVYFQLYLKPSQ
DINRVLVARIIEAVTKGCCLQTDGLNSKFLDFFSKAIQHARQEKSSAGLNHILAAFIIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYASRKWKSILYNVYDLLVNEISHIGSRGKYSSGSRNIAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQREFSDYNAPCKKKKIELGWEVIKDHLQKSQNDFNIVPWLQIATQLI
SKYPSSLPNCELSPLLMILHQLLPQQRHGERTPYVLRCLMEVALCQGKKSNLESSQKSDL
LKLWIKIWSITFRGISSEQIQAENFGLLGAIIQGSLVEVDKEFWKLFTGSACRPSCPAVC
CLTLALTICVVPETVKTGMEKNIYDVNRNFSLKELIMKWLLFHQLEDDFEDSAELPPILH
SNFPHLALEKILVSLTMKNCKAAMNFFQSVPECEQHQKDTEEPSFSEVEELFLQTTFDKM
DFLTIVKEHTTEKHQSSVGFSVHQNLKQSLDRYLLGLSEQLLNNYSSETSNSEMLVRCSS
LLVGVLGCYCYVGVIAEEEAYKSELFQKAKSLMQYAGESITLFKNKTNEESRIVSLRNMM
HLCTRCLHNCTKHSPNKIASGFFLRLLTSKLMNDIADICTNLVSIIKKPFDFGEVESVED
STDENLMEMEDQSSMNLFNDYPASSVIDANESGESQITIGAMNPLAEEHLSKQDLLFLDM
LKFLCMCVTTAQTNTVSFRAADIRRKLLMLIDSSMLDLTKSLHLHMYLVLLKDLPGEEYP
LPMEDVVELLKPLSNVCSLYRRDQDVCKTILNHVLHIVTNLCQGNMDAENTRDAQGQFLT
VIEAFWHLTKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMGKDFPVNEVFPQFLAD
NHHQVRMLAAQSINRLFQHMKKGGPSTLLKALPLKLQQAAFENSHLKAQEGMREVSHRAE
NSEILDELCNRKAILLMMIAVVLYYSPVCEKQALFALCKSVKENGLEPHLIKKVLQKVSE
TFGYRHLEDFMASHLDYLVLQWLNLQDTEYSLSSFPFTLLNYTNIEDFYRSCYKVLIPHL
VIRSHFDEVKSIANQIQKDWKSLLTDCFPKIIVNILPYFAYEDTGDSGMAQQRKIATKVY
DMLKDENLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAVETNNVYKKHRIL
KIYHLFVSLLMDDIKSGLGGAWAFVLRDVIYTLIHYINQRPSHFMDVSLRSFSLCCDLLS
RVCHTAVTFCKDALESHLHVIVGTLIPLVDDQMEVQEQVLDLLKYLVIDNKDNENLYIMI
KLLDPFPDHVVFRDLRITQQKIKYSRGPFSLLEEINHFLSVNVYDALPLTRLEGLKDLRR
QLEQHKDQMMDLMRASQDNPPDGVMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVG
PIDFSTIAIQYSKDTSYTKALELFEDKELQWTFIMLTYLNNTLVEDCVKVRSAAVTCLKS
ILATKTGHSFWEIYKMTNDPMLIYLQPFRTSRKKFLEVPRLDKESPLEGLDDTSLWIPQS
ENHDIWLKTLTCAFLNSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILIQDTNESWR
NLLSTHIQGFFTNCFRHCSETSRSTTPANLDSESEHFFRCHLDKKSQRTMLAVVDYMRRQ
KRPSSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNMDDQEKRGALVTN
RSLMFEEGSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKILQPLTR
LRTYEHEAMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLRGLDHENKEWC
AELQELHYQVAWRNMQWDHCISVNKGIEGTSYHESLYNALQSLRDGEFSTFYESLKYARV
KEVEELCKGSLESVYSLYPTLSRLQAIGELENIGELFSRSITDRQPSEVYIKWWKHSQLL
KDSDFSFQEPIMALRTVILEILMEKEMENSQRECLKDILTKHLVELSVLARTFKNTQLPE
RAIFQIKQYNSSSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLGASCTENDPNLKL
IYTECLRVCGTWLAETCLENPAVIMQTYLEKAVEVAGNYDGESNDGLRNGQMKAFLSLAR
FSDSQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECAL
HALKEDRKRFLCKAVENYINCLLSGEGHDTWIFRLCSLWLENSGVSEVNGMMKRDGMKIP
SYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFL
TKPEAARRSRITKNAPKQSSQLDEDRTEAANKIIRTMRSRRPQMVRSVEALCDAYIILAN
LDATQWKTQRKGISIPADQPIIKLKNLEDVVVPTMEIKVDPTGEYGNLVTIQSFKAEFRL
AGGLNLPKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTI
CTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNESGAHKRYRPKDFSAYQCQKKMMDVQKKS
FEEKYETFMEICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCE
KTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESELHSTPNADDQECK
RNLSDIDHSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGW
KAWV
NT seq 9195 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaagaggttgagaaatttaagcgcctgattcaggatcctgaaaccgtt
caacatttagatcagcattcagattccaaacaagggaaatatttgaattgggatgctgtt
tttagagttttacagaaatatattcagaaagaaacggaatgtctgagaacagcaaaacca
aatgtatcaacctcaacacaagccaccaggcagaaaaagatgcaagaaatcagtagctta
gtcaaatacttcatcaaatgtgcaaataaaagagcacccaggctaaaatgtcaagaactc
ttgaattatatcatggagacagtgaaagattcatctaatggtgccatttatggagctgat
tgtagcaacatattgctgaaggacattctttcagtgagaaaatactggtgtgaaatatct
cagcaacagtggacagaattgttctctgtgtacttccagctgtatcttaaaccttcacaa
gacattaatagggttttggtggctagaataattgaagctgtgaccaaaggatgctgtttg
cagactgatggattaaattccaaatttttggattttttttctaaggctattcagcatgca
agacaagaaaagagctctgcaggtctaaatcatatcttagcagcatttattatcttcctc
aagactttggctgttaactttcgaattcgagtatgtgaattaggagatgaaattcttcct
accttactttatatctggactcaacatagacttaatgattccttaaaagaagtaattatt
gagttatttcaactacaaatttatatccatcatccaaagggagccaaaactcaagaaaaa
ggtgcctatgcatcacgaaagtggaagagtatcttatacaatgtatatgatctgctagtt
aatgaaataagtcatataggaagcagagggaaatattcttcaggatctcgtaatattgct
gtcaaggaaaacttgattgaattgatggcagatatttgtcaccaggtttttaatgaagat
actagatctttggagatttctcagtcttacacaaccacacaaagagaatttagtgattac
aatgcaccttgcaaaaagaagaaaatagaattaggctgggaagtaataaaagatcatctt
cagaagtcacagaatgattttaacattgtgccttggttacagattgcaactcaattaata
tcaaaatatccttcaagtttacctaactgtgagttgtcaccattactaatgatactacac
cagcttctacctcaacaacgacatggggaacgcacaccatatgtgttacgatgccttatg
gaagttgcattgtgtcaaggcaagaaatcaaacctagaaagctctcaaaagtcagattta
ttgaaactctggattaaaatttggtctattacttttcgtggtataagttctgaacaaata
caagctgaaaactttggcttacttggagccataattcaaggcagtttagttgaagttgac
aaagaattctggaagttatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgtttgactttggcactgaccatctgtgtagttccagaaacagtaaaaacaggaatggag
aagaatatatatgatgtaaacagaaatttttctttaaaggaattgataatgaaatggctc
ttattccatcagttagaggatgactttgaagacagtgcagagctgcctccaattcttcac
agtaattttcctcatcttgccctggagaaaattcttgtgagtctcactatgaaaaactgt
aaagctgcaatgaattttttccaaagtgtgccagaatgtgagcaacaccaaaaagataca
gaagaaccttcattctcagaagttgaagaactatttcttcagacaacttttgacaagatg
gattttttaaccattgtgaaagaacatactacagaaaagcaccaatccagtgtaggcttt
tctgtccaccaaaatctcaagcaatcactggatcgctatcttctgggattgtcagagcag
cttctaaataattactcatctgagacttcaaattcagaaatgcttgtccggtgttcaagt
cttttggtgggtgttctcggctgctattgttatgtgggtgtaatagctgaagaggaagca
tacaaatcagaattattccagaaagccaagtctctaatgcagtatgcaggagaaagtatc
actttgtttaaaaataagacaaatgaagaatctagaattgtttcactgagaaatatgatg
catctatgtacacgttgcttacataactgtaccaagcacagtccaaataagattgcatct
ggcttcttcctgcgattattaacatcaaagctaatgaatgatattgcagatatttgtaca
aatttagtatccattatcaaaaagccatttgactttggagaagtagaatcagtggaagat
agtactgatgaaaatctaatggagatggaggatcagtcatccatgaatctatttaatgat
taccctgctagtagtgttattgatgcaaatgaatctggagagagccaaattactattggt
gccatgaatcctttagctgaagaacatctgtcaaagcaagatctactttttttagacatg
ctcaagttcttgtgtatgtgtgtaaccactgctcagaccaatactgtatcatttagagca
gctgatattcgaaggaaattgttaatgttaattgattctagcatgctagaccttaccaaa
tctctccatctacacatgtatctagtgcttttaaaggaccttcctggagaagaatatccc
ttgccaatggaagatgttgttgaacttctaaaaccactatccaatgtgtgttctttgtat
cgccgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcacatagtgacgaac
ctatgtcaaggaaatatggatgctgagaacacaagggatgctcaaggacagtttctaaca
gtgattgaagcattttggcacttaacaaaggagggaaaatgcacattctctgtaagaatg
gcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgggctatt
ctgaatgtaatgggaaaagacttccctgtaaatgaagtatttccacagtttcttgctgat
aatcatcaccaagttcgcatgttggctgcacagtcaatcaatagattatttcagcatatg
aaaaaaggaggtccttccacattattgaaagcacttcctttgaagcttcagcaagcagca
tttgaaaattcacacttgaaagctcaggaaggaatgagagaagtgtcccacagagctgaa
aactctgaaattttggatgagctttgtaatagaaaggccattttactgatgatgatagct
gtggtgttatactatagccctgtatgtgaaaaacaggctttatttgccctatgcaagtct
gtgaaagagaatggattagagcctcacctcattaaaaaggttttacagaaagtttctgaa
acttttggatatagacacttagaagacttcatggcttctcatttggattatctggtattg
caatggctaaatcttcaagatactgaatacagcttatcttcttttccttttactttatta
aactacacaaacattgaagatttctacaggtcttgttataaagttttgattccacatctg
gtgattagaagtcattttgatgaggtaaagtccattgctaatcagattcaaaaggattgg
aaaagtcttctgacagactgctttccaaagataattgtaaatattcttccatacttcgct
tatgaggatacaggagacagtgggatggcacagcaaagaaagattgctaccaaagtctat
gatatgcttaaagatgaaaacttattaggaaaacagattgatcatttattcattagtaat
ttaccagagattgtggtggagttattaatgacgttacatgaaccagcaacttctggtgcc
agccaaagcactgacccctgtgacttttcaggggatttggatcctgctcctaatccacct
cattttccatcacatgtgattaaagcgacatttgcctatatcagcaattgccacaaaacc
aagcttaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaattctt
ctggccatatgtgagcaagcagttgagacaaataatgtttataaaaaacatagaattctt
aaaatatatcacctgtttgttagtttattaatggacgatataaagagtggcttaggagga
gcttgggcctttgttcttcgagatgttatttatactttgattcactatatcaaccaaagg
ccttctcatttcatggatgtgtcattacgtagcttctccctttgttgtgacctgttaagc
cgggtttgccacacagcagtaactttctgtaaggatgctttagaaagtcatctccatgtt
attgttggtacacttataccccttgtggatgatcagatggaggttcaggaacaggtattg
gacttgttgaaatacttagtgattgataacaaggataatgaaaatctctatatcatgatt
aaacttttagatccttttcctgaccatgttgtctttagggatttgcgtattactcagcag
aaaatcaaatacagtagaggacccttttcacttttggaggaaattaaccattttctctca
gtaaatgtttatgatgcacttccattgacaaggcttgaaggattgaaggatcttcgaaga
caactagagcaacataaagatcagatgatggatcttatgagagcatctcaggataaccct
ccagatggcgtaatggtgaagctagttgtcagcttgttgcagttatccaagatggcagta
aaccacactggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggt
cctatagatttctctacaatagctatacaatatagtaaagatacatcttataccaaggcc
cttgagttatttgaagataaagaacttcagtggaccttcataatgctgacctacctgaat
aatacactggtagaagattgtgtcaaagtgcgatcagcagctgttacctgtttgaaaagc
attttagccacaaaaactggacatagtttctgggagatttataagatgacaaatgatccc
atgctgatctatctacagccttttcgaacatcaaggaaaaagtttttagaagtacctaga
cttgacaaagaaagtcctttagaaggcttggatgatacaagcctgtggattcctcaaagt
gaaaatcatgacatttggttaaagacactgacttgtgcttttttgaatagtggaggcaca
aaaagtgaagttcttcagttattaaagccaatgtgtgaggtgaaaactgacttttgtcag
actgtgcttccatacttgatccatgacattttaatccaagatacaaatgaatcatggaga
aatctgctttctacacacattcagggatttttcactaactgtttcagacactgctcagaa
acaagccgatccacaactcctgcaaatttggattcagagtcagagcactttttccgatgc
catttggataaaaaatcacaaagaacaatgcttgctgttgtggactacatgaggagacaa
aagagaccttcttcaggaacagtttttgatgatgctttctggctggaattgaattatcta
gaggttgccaaggtagctcagtcttgtgctgctcattttacagcattgctctatgcagaa
atctatgcagataagaagaatatggacgatcaagagaaaagaggtgctcttgtgacaaac
agaagtcttatgtttgaagaaggaagccagagtacaactatttccagtttgagtgaaaaa
agtaaggaagaaactggaataagtttacaggatctgctcttagaaatctacagaagtata
ggagagccagatagtctttatggttgtggtggagggaaaatattacaaccccttactaga
ctgcgaacatatgaacatgaagcaatgtgggggaaagccctagtaacatatgaccttgag
acagcaatctcctcctcaactcgccaggcaggaataatccaggccttgcagaatttggga
ctctgccatatcctttccgtctatttaaggggattagatcatgaaaataaagagtggtgt
gctgaactacaggaacttcattaccaagtagcatggaggaatatgcagtgggaccactgc
atttctgtcaacaaaggaatagaaggaaccagttaccatgaatcattgtataatgctctg
cagtctctaagagatggggaattctccactttttatgaaagtctcaaatatgccagagtt
aaagaagtggaagagttgtgtaagggcagtcttgagtctgtgtattccctctaccctaca
cttagcagattgcaggccatcggagagctcgaaaacattggggagcttttctcaagatca
ataacagataggcagccctctgaagtatacattaagtggtggaaacattcccagcttctc
aaagacagtgattttagttttcaggagcctataatggctctacgcacagtcattttggag
atcttgatggaaaaggaaatggaaaactcgcaaagagagtgtcttaaggatattctcacc
aagcatcttgtagaactctctgtattagcccgaactttcaagaacactcagcttcctgaa
agggcaatatttcaaattaaacaatataattcatctagttgtggagtctctgagtggcag
ctggaggaagcacaagtattctgggcaaaaaaggaacagagtcttgccctgagtattctc
aagcaaatgatcaagaagctgggtgccagttgtacagagaatgatcccaacctaaaacta
atatacacagaatgtctgagggtttgtggcacctggttagcagaaacttgtttagaaaat
cctgcagtcatcatgcagacctatctagaaaaggcagtggaagttgctggaaattatgat
ggagaaagcaatgatgggctcagaaatggacaaatgaaggcatttctatcattagcacgg
ttctcagatagtcagtaccaaagaattgaaaactacatgaaatcgtcagaatttgaaaac
aagcaagctctcctgaaaagagctaaagaggaagttggccttcttagggaacataaaatt
cagaccaacaggtacacagtaaaggttcagcgagagctggagttggatgaatgtgcactc
catgcattgaaagaagatcgtaaacgtttcttatgtaaggcagttgaaaattacatcaat
tgcttattaagtggagaagggcatgatacgtggatattccgtctttgttccctctggctt
gaaaattctggtgtttctgaagtcaatggcatgatgaagagagatggaatgaagattcca
tcatataaatttttgcctcttatgtaccaattggctgctagaatggggactaagatgatg
ggaggcctaggatttcatgaagtcctcaataatctcatctctagaatttcaatggatcac
cctcatcatactttgtttattatactggctttagcaaatgcaaacaaagatgaatttttg
accaaaccagaggcagcaagaaggagtagaataactaaaaatgcacctaaacaaagctct
cagcttgatgaggatcgaaccgaggctgcaaacaaaataatacgtactatgagaagcagg
agacctcagatggtcagaagtgttgaggcactttgtgatgcttacattatactagcaaat
ttagatgccactcagtggaagactcagagaaaaggcataagtattccggcagaccagccc
attatcaaacttaaaaatttagaagatgttgttgttcctactatggaaattaaggtggac
cccacaggggaatatggaaatctggtgactatacagtcatttaaagcagaatttcgttta
gcaggaggtttaaatttaccaaaaataatagattgtttgggttctgatggcaaggaaagg
agacagcttgtcaagggccgcgatgacctgagacaagatgctgtcatgcagcaggttttc
cagatgtgtaatacattgctgcagagaaatactgaaaccaggaagaggaagttgactatc
tgtacatataaggtggttcccctttctcagcgaagtggtgttcttgaatggtgcacagga
actgtccctattggtgaatttcttgttaacaatgagagtggtgctcataaaagatacagg
ccaaaggatttcagtgcctatcagtgtcaaaagaaaatgatggatgtacaaaaaaagtct
tttgaagagaaatatgaaaccttcatggagatttgccaaaattttcaaccagttttccgt
tacttctgcatggaaaaattcttggatccagctgtttggtttgagaaacgattggcttat
actcggagtgttgctacttcttctattgttggttacatacttggacttggtgatagacat
gtacagaatatcttgataaatgagcagtcagcagaacttgtacatatagatttaggagtt
gcttttgaacagggtaaaatccttcctactcctgaaacagttcccttcagactcaccaga
gatattgtggatgggatgggcattactggtgtagaaggtgtcttcagaagatgctgtgag
aaaaccatggaggttatgagaaactctcaggaaaccctgttaaccattgtagaggtcctc
ctgtatgatcctctctttgactggacaatgaatcctttgaaagctctgtatttacagcag
aggccagaggatgaaagtgagctccactccactccaaatgcagatgaccaggaatgcaaa
cgaaatctcagtgatattgaccacagtttcaacaaagtagctgaacgtgtcttgatgaga
ctgcaagagaaactaaaaggagtggaggaaggaaccgtgctcagtgttggtggacaggtg
aatttgctcatacaacaggccatggaccccaaaaatctcagccgacttttcccaggctgg
aaagcttgggtgtga

DBGET integrated database retrieval system