KEGG   Delphinapterus leucas (beluga whale): 111168108
Entry
111168108         CDS       T05885                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04024  cAMP signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04310  Wnt signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04530  Tight junction
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04926  Relaxin signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05231  Choline metabolism in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111168108 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111168108 (MAPK10)
   04012 ErbB signaling pathway
    111168108 (MAPK10)
   04014 Ras signaling pathway
    111168108 (MAPK10)
   04310 Wnt signaling pathway
    111168108 (MAPK10)
   04668 TNF signaling pathway
    111168108 (MAPK10)
   04068 FoxO signaling pathway
    111168108 (MAPK10)
   04071 Sphingolipid signaling pathway
    111168108 (MAPK10)
   04024 cAMP signaling pathway
    111168108 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111168108 (MAPK10)
   04137 Mitophagy - animal
    111168108 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    111168108 (MAPK10)
   04215 Apoptosis - multiple species
    111168108 (MAPK10)
   04217 Necroptosis
    111168108 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168108 (MAPK10)
   04530 Tight junction
    111168108 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111168108 (MAPK10)
   04621 NOD-like receptor signaling pathway
    111168108 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    111168108 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    111168108 (MAPK10)
   04660 T cell receptor signaling pathway
    111168108 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    111168108 (MAPK10)
   04659 Th17 cell differentiation
    111168108 (MAPK10)
   04657 IL-17 signaling pathway
    111168108 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    111168108 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111168108 (MAPK10)
   04920 Adipocytokine signaling pathway
    111168108 (MAPK10)
   04912 GnRH signaling pathway
    111168108 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    111168108 (MAPK10)
   04917 Prolactin signaling pathway
    111168108 (MAPK10)
   04926 Relaxin signaling pathway
    111168108 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    111168108 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    111168108 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    111168108 (MAPK10)
   04722 Neurotrophin signaling pathway
    111168108 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111168108 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111168108 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168108 (MAPK10)
   05231 Choline metabolism in cancer
    111168108 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111168108 (MAPK10)
   05212 Pancreatic cancer
    111168108 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111168108 (MAPK10)
   05012 Parkinson disease
    111168108 (MAPK10)
   05016 Huntington disease
    111168108 (MAPK10)
   05017 Spinocerebellar ataxia
    111168108 (MAPK10)
   05020 Prion disease
    111168108 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    111168108 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111168108 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111168108 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    111168108 (MAPK10)
   04931 Insulin resistance
    111168108 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111168108 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111168108 (MAPK10)
   05135 Yersinia infection
    111168108 (MAPK10)
   05133 Pertussis
    111168108 (MAPK10)
   05152 Tuberculosis
    111168108 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111168108 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    111168108 (MAPK10)
   05161 Hepatitis B
    111168108 (MAPK10)
   05171 Coronavirus disease - COVID-19
    111168108 (MAPK10)
   05162 Measles
    111168108 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111168108 (MAPK10)
   05169 Epstein-Barr virus infection
    111168108 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111168108 (MAPK10)
   05142 Chagas disease
    111168108 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111168108 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111168108 (MAPK10)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111168108 (MAPK10)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111168108 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 111168108
NCBI-ProteinID: XP_022417377
UniProt: A0A2Y9MEB4
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAALDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNTSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagccttcatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgctcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagattttggactggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga
acaccatgcccagaattcatgaagaaactgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat
gtgtggtatgatcctgccgaagtggaggcgcccccaccccagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgaat
tcagaagaaaagactaagaatggcgttgtgaaaggacagccttctccttcaggtgcagca
gtgaacaccagtgagagtctccctccatcctcgtctgtcaacgatatctcctccatgtcc
actgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Delphinapterus leucas (beluga whale): 111169265
Entry
111169265         CDS       T05885                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04024  cAMP signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04310  Wnt signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04530  Tight junction
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04926  Relaxin signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05231  Choline metabolism in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111169265 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111169265 (MAPK9)
   04012 ErbB signaling pathway
    111169265 (MAPK9)
   04014 Ras signaling pathway
    111169265 (MAPK9)
   04310 Wnt signaling pathway
    111169265 (MAPK9)
   04668 TNF signaling pathway
    111169265 (MAPK9)
   04068 FoxO signaling pathway
    111169265 (MAPK9)
   04071 Sphingolipid signaling pathway
    111169265 (MAPK9)
   04024 cAMP signaling pathway
    111169265 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111169265 (MAPK9)
   04137 Mitophagy - animal
    111169265 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    111169265 (MAPK9)
   04215 Apoptosis - multiple species
    111169265 (MAPK9)
   04217 Necroptosis
    111169265 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169265 (MAPK9)
   04530 Tight junction
    111169265 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111169265 (MAPK9)
   04621 NOD-like receptor signaling pathway
    111169265 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    111169265 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    111169265 (MAPK9)
   04660 T cell receptor signaling pathway
    111169265 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    111169265 (MAPK9)
   04659 Th17 cell differentiation
    111169265 (MAPK9)
   04657 IL-17 signaling pathway
    111169265 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    111169265 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111169265 (MAPK9)
   04920 Adipocytokine signaling pathway
    111169265 (MAPK9)
   04912 GnRH signaling pathway
    111169265 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    111169265 (MAPK9)
   04917 Prolactin signaling pathway
    111169265 (MAPK9)
   04926 Relaxin signaling pathway
    111169265 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    111169265 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    111169265 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    111169265 (MAPK9)
   04722 Neurotrophin signaling pathway
    111169265 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111169265 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111169265 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169265 (MAPK9)
   05231 Choline metabolism in cancer
    111169265 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111169265 (MAPK9)
   05212 Pancreatic cancer
    111169265 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111169265 (MAPK9)
   05012 Parkinson disease
    111169265 (MAPK9)
   05016 Huntington disease
    111169265 (MAPK9)
   05017 Spinocerebellar ataxia
    111169265 (MAPK9)
   05020 Prion disease
    111169265 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    111169265 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111169265 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111169265 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    111169265 (MAPK9)
   04931 Insulin resistance
    111169265 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111169265 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111169265 (MAPK9)
   05135 Yersinia infection
    111169265 (MAPK9)
   05133 Pertussis
    111169265 (MAPK9)
   05152 Tuberculosis
    111169265 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111169265 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    111169265 (MAPK9)
   05161 Hepatitis B
    111169265 (MAPK9)
   05171 Coronavirus disease - COVID-19
    111169265 (MAPK9)
   05162 Measles
    111169265 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111169265 (MAPK9)
   05169 Epstein-Barr virus infection
    111169265 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111169265 (MAPK9)
   05142 Chagas disease
    111169265 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111169265 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111169265 (MAPK9)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111169265 (MAPK9)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111169265 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 111169265
NCBI-ProteinID: XP_022419022
UniProt: A0A2Y9MJ04
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc
actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtc
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacagaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaag
tcagactgtacccttaagatccttgactttggcctggctcgcacagcatgcaccaacttt
atgatgaccccctacgtggtaacgcggtattatcgggcacctgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattacgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttactatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtttggtatgaccctgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtgaaagatcaaccttcagatgcagca
gtaagtagcaacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtctggatgcctcaacaggacccctt
gaaggttgtcgatga

KEGG   Delphinapterus leucas (beluga whale): 111169895
Entry
111169895         CDS       T05885                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04024  cAMP signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04141  Protein processing in endoplasmic reticulum
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04310  Wnt signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04530  Tight junction
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04668  TNF signaling pathway
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04728  Dopaminergic synapse
dle04750  Inflammatory mediator regulation of TRP channels
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04917  Prolactin signaling pathway
dle04920  Adipocytokine signaling pathway
dle04926  Relaxin signaling pathway
dle04930  Type II diabetes mellitus
dle04931  Insulin resistance
dle04932  Non-alcoholic fatty liver disease
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05016  Huntington disease
dle05017  Spinocerebellar ataxia
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05210  Colorectal cancer
dle05212  Pancreatic cancer
dle05231  Choline metabolism in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111169895 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111169895 (MAPK8)
   04012 ErbB signaling pathway
    111169895 (MAPK8)
   04014 Ras signaling pathway
    111169895 (MAPK8)
   04310 Wnt signaling pathway
    111169895 (MAPK8)
   04668 TNF signaling pathway
    111169895 (MAPK8)
   04068 FoxO signaling pathway
    111169895 (MAPK8)
   04071 Sphingolipid signaling pathway
    111169895 (MAPK8)
   04024 cAMP signaling pathway
    111169895 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111169895 (MAPK8)
   04137 Mitophagy - animal
    111169895 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    111169895 (MAPK8)
   04215 Apoptosis - multiple species
    111169895 (MAPK8)
   04217 Necroptosis
    111169895 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169895 (MAPK8)
   04530 Tight junction
    111169895 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111169895 (MAPK8)
   04621 NOD-like receptor signaling pathway
    111169895 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    111169895 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    111169895 (MAPK8)
   04660 T cell receptor signaling pathway
    111169895 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    111169895 (MAPK8)
   04659 Th17 cell differentiation
    111169895 (MAPK8)
   04657 IL-17 signaling pathway
    111169895 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    111169895 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111169895 (MAPK8)
   04920 Adipocytokine signaling pathway
    111169895 (MAPK8)
   04912 GnRH signaling pathway
    111169895 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    111169895 (MAPK8)
   04917 Prolactin signaling pathway
    111169895 (MAPK8)
   04926 Relaxin signaling pathway
    111169895 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    111169895 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    111169895 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    111169895 (MAPK8)
   04722 Neurotrophin signaling pathway
    111169895 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111169895 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111169895 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169895 (MAPK8)
   05231 Choline metabolism in cancer
    111169895 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111169895 (MAPK8)
   05212 Pancreatic cancer
    111169895 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111169895 (MAPK8)
   05012 Parkinson disease
    111169895 (MAPK8)
   05016 Huntington disease
    111169895 (MAPK8)
   05017 Spinocerebellar ataxia
    111169895 (MAPK8)
   05020 Prion disease
    111169895 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    111169895 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111169895 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111169895 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    111169895 (MAPK8)
   04931 Insulin resistance
    111169895 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111169895 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111169895 (MAPK8)
   05135 Yersinia infection
    111169895 (MAPK8)
   05133 Pertussis
    111169895 (MAPK8)
   05152 Tuberculosis
    111169895 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111169895 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    111169895 (MAPK8)
   05161 Hepatitis B
    111169895 (MAPK8)
   05171 Coronavirus disease - COVID-19
    111169895 (MAPK8)
   05162 Measles
    111169895 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111169895 (MAPK8)
   05169 Epstein-Barr virus infection
    111169895 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111169895 (MAPK8)
   05142 Chagas disease
    111169895 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111169895 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111169895 (MAPK8)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111169895 (MAPK8)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111169895 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 111169895
NCBI-ProteinID: XP_022420216
UniProt: A0A2Y9MMF5
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacattgtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaaa
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtactgatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaataaacttaaagccagtcaggcaagggatttgttatctaaa
atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccatat
atcaacgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system