KEGG   Delphinapterus leucas (beluga whale): 111168228
Entry
111168228         CDS       T05885                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04510  Focal adhesion
dle04621  NOD-like receptor signaling pathway
dle05145  Toxoplasmosis
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111168228 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111168228 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111168228 (XIAP)
   04215 Apoptosis - multiple species
    111168228 (XIAP)
   04217 Necroptosis
    111168228 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168228 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111168228 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168228 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111168228 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111168228 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111168228 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111168228 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111168228 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111168228 (XIAP)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111168228 (XIAP)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111168228 (XIAP)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I32: IAP family
   111168228 (XIAP)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111168228 (XIAP)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    111168228 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 111168228
NCBI-ProteinID: XP_022417552
UniProt: A0A2Y9M745
LinkDB
Position
Unknown
AA seq 497 aa
MTFNSFEGSKTCVPADISKDEEFVEEFNRLKTFSNFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFESNAAQLTNPGVQNGQYKAENC
LGNRNHFVLERPSETHADYLLRTGQVVDLSDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNFNIQSE
SDVVSSDRNFPNSTNPPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHATWYPGCRFLLEEKGQEYINNIHLTHSIEESLTRTAEKTP
SLTKRTDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQTSGSNYKSLEVLVADLVSAQKD
NTQDELGQTSLQKEISTEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcagtaaggat
gaagaatttgtagaagagtttaatagattaaaaactttttctaattttccaagtagtagt
cctgtttcagcatcaacactagcacgagctggttttctatacactggtgaaggagacacc
gtgcggtgctttagttgtcatgcagcagtagatagatggcagtatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttatttcgaaagt
aatgctgcacagcttacaaatcctggtgtccaaaatggtcagtacaaagctgaaaactgt
ctgggaaacagaaatcattttgttttagaaaggccatctgagactcatgcagactatctt
ttgagaactggacaggttgtagatctatcagacaccatatacccaaggaaccctgccatg
tgtagtgaagaagctagattaaagtcatttcaaaactggccagactatgcccacttaacc
ccaagagagttagctagtgctggactctactacacgggtattgatgatcaagtacaatgc
ttttgttgtggcgggaaactgaaaaattgggaaccttgtgatcgtgcatggtcagaacac
aggcgacactttcctaattgcttctttgtattgggccggaattttaatattcaaagtgaa
tctgatgtcgtgagttctgataggaatttcccaaattcaacaaatcctccaagaaatcca
gccatggcagattacgaagcacggatcattacatttgggacgtggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctacgtggtatccagggtgtagatttctgttagaagagaagggacaagaatacataaac
aatattcatttaacccattcaattgaggagtctctgacgagaactgctgaaaaaacacca
tcattaactaaaagaactgatgataccatattccaaaatcctatggtacaagaagctata
cgaatgggattcagtttcaaggacattaagaaaataatggaggaaaaaattcagacatct
gggagcaactataaatcacttgaagttctggttgcagatctagtgagtgctcagaaagac
aatacacaagatgaattaggtcagacttcgttacagaaagagattagtactgaagagcag
ctaaggctactgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgta
gtttttattccttgtggacatctggtcacttgtaaacagtgtgcagaagcagtggacaaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Delphinapterus leucas (beluga whale): 111168369
Entry
111168369         CDS       T05885                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04390  Hippo signaling pathway
dle04510  Focal adhesion
dle04621  NOD-like receptor signaling pathway
dle04668  TNF signaling pathway
dle05132  Salmonella infection
dle05145  Toxoplasmosis
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111168369 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111168369 (BIRC2)
   04064 NF-kappa B signaling pathway
    111168369 (BIRC2)
   04668 TNF signaling pathway
    111168369 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111168369 (BIRC2)
   04215 Apoptosis - multiple species
    111168369 (BIRC2)
   04217 Necroptosis
    111168369 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168369 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111168369 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168369 (BIRC2)
   05202 Transcriptional misregulation in cancer
    111168369 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111168369 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111168369 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111168369 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111168369 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111168369 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111168369 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111168369 (BIRC2)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I32: IAP family
   111168369 (BIRC2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111168369 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C zf-RING_UBOX
Other DBs
NCBI-GeneID: 111168369
NCBI-ProteinID: XP_022417767
UniProt: A0A2Y9MFG0
LinkDB
Position
Unknown
AA seq 620 aa
MHKTTSQRLFPDPLYQKIKSMMEDSTILSNWTTVNKQKMKYDFSCELYRMSTYSTFPVGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSVT
SLESTSKNVSSSMRNNFTHSLLPTLEHSSLFSGSYSNLSPNPVNSRAVEDFSPMRTNPYS
YAMSTEEARFLTYQMWPLTFLSPSELARAGFYYIGPGDRVACFACGGTLSNWEPKDDAVS
EHRRHFPNCPFLENSLETLRFSISNLSMQTHAARLRTFMYWPSTVPVQPEQLASAGFYYV
GRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGREFVDEIQARYPHLLEQ
LLSTSDTPGDENADPPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRSLVKQTIQSKIL
TTGENYRTVNDIVSALLNAEDEKREEEKERQTEETASDDLSLIRRNRMALFQQLTCVLPI
LDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNGAANIFKNCLQEIDSTLYKN
LFVEKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPS
LRKCPICRGIIKGTVRTFLS
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgcacaaaactacctcccaaagacttttcccagatcccttgtatcaaaaaattaagagt
atgatggaagatagcacgatcttgtcaaattggacaactgtcaacaaacaaaaaatgaaa
tatgacttttcatgtgaactctaccgaatgtctacatattcaactttccccgttggtgtt
cctgtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtgaatgacaaa
gtcaaatgcttttgttgtggcctgatgctggataactggaaacaaggagacaatcctatt
gaaaagcataaacaactgtatcctagctgtagctttattcagaatctagtttctgttact
agtctggaatccacctctaaaaatgtttcctcttcaatgagaaacaattttacacattca
ttattacctactttggaacatagtagcttgttcagtggttcttattccaacctttcacca
aaccctgttaattctagagcagttgaagacttttccccaatgaggactaacccctacagt
tatgccatgagtactgaagaagcgagatttcttacttaccagatgtggccattaaccttt
ttgtcaccatcagaattggcaagagctggcttttattatataggacctggagatagagta
gcctgctttgcctgtggtgggactctaagtaactgggaaccaaaggatgatgctgtgtca
gaacaccggagacatttccccaactgtccatttttggaaaattctctggaaacgctgagg
tttagcatttcaaatttgagcatgcagacacatgcagctcgactgagaacatttatgtac
tggccttcaactgtaccagttcagcctgagcagcttgcaagtgctggtttctattatgtg
ggtcgcaatgatgatgtcaaatgcttttgttgtgacggtggcttaaggtgttgggaatct
ggagatgacccatgggttgaacacgccaagtggtttccaaggtgtgagttcttgatacgc
atgaaagggcgggagtttgttgatgagattcaagctaggtatcctcatcttcttgaacag
ctattgtcaacttcagatactcctggagatgaaaatgctgatccaccaattgttcatttt
ggacctggggaaagttcttcagaggatgcagtcatgatgaatacacctgtggttaaagct
gccttggaaatgggctttagtagaagcctggtaaagcagacaattcagagtaaaatccta
acaactggagagaattacagaacagttaatgatattgtgtcagcacttcttaatgctgaa
gatgaaaagagagaagaagagaaggagagacaaactgaagaaacagcatcagatgatttg
tccttgattcggaggaatagaatggctctctttcaacagttgacatgtgtgcttcctatc
ctggataatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaa
aaaacacagatacctttgcaagcaagagaactgattgataccattttagttaaaggaaat
ggtgctgccaacatcttcaagaactgtcttcaagaaattgactctacattatataagaac
ttatttgtggaaaagaatatgaagtatattccaacagaagatgtttcaggtctgtcactg
gaagaacaattgagaaggttgcaagaagaaagaacttgtaaagtgtgtatggacaaagaa
gtttctattgtattcattccttgtggtcatctggtagtatgccaggaatgtgccccttct
ctaagaaaatgccctatttgcaggggtataattaagggtactgttcgtacatttctctca
taa

KEGG   Delphinapterus leucas (beluga whale): 111168370
Entry
111168370         CDS       T05885                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04064  NF-kappa B signaling pathway
dle04120  Ubiquitin mediated proteolysis
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04390  Hippo signaling pathway
dle04510  Focal adhesion
dle04621  NOD-like receptor signaling pathway
dle04668  TNF signaling pathway
dle05132  Salmonella infection
dle05145  Toxoplasmosis
dle05168  Herpes simplex virus 1 infection
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111168370 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111168370 (BIRC3)
   04064 NF-kappa B signaling pathway
    111168370 (BIRC3)
   04668 TNF signaling pathway
    111168370 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111168370 (BIRC3)
   04215 Apoptosis - multiple species
    111168370 (BIRC3)
   04217 Necroptosis
    111168370 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168370 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111168370 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168370 (BIRC3)
   05202 Transcriptional misregulation in cancer
    111168370 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111168370 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111168370 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111168370 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111168370 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111168370 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111168370 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111168370 (BIRC3)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I32: IAP family
   111168370 (BIRC3)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111168370 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 111168370
NCBI-ProteinID: XP_022417769
UniProt: A0A2Y9M6K0
LinkDB
Position
Unknown
AA seq 604 aa
MNIVENSVFLSNLMKSANIFELKYDFSCELYRMSTYSAFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFVQNLNSVNISGATSQPTFPSSVTNS
THLLLPSLENSGCFSGSYSSFPSNLLNSGPNQDFSALRISPYHCAMNTEKARLLTFQMWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPNCPFLGSQLQ
GTSRYTVSNLSMQTYAARFKTFCNWPSSVPVHPEQLASAGFYYMGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFISRVQASYPHLLEQLLSTSDNPEDENAESP
IVHFGPGENHSEDAVMMNTPVVKAALEMGFSRRLIKQTVQSKILTTGENYRTVSDLVLDL
LNAEDEIREEEKERATEEKESDDLSLIRKNRMALFQRLTCALPILDSLLTARVISEQERD
VIKQKTQTSLQARELIDTILVKGNFAATIFKNSLQEIDPMLYQHLFVQQDIKYIPTENVS
DLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaatagcgtattcttatcaaatttgatgaaaagtgccaacatattt
gaattgaagtatgacttttcatgtgagctgtaccgaatgtctacctattcggctttcccc
gctggtgttcctgtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtg
aatgacaaggtcaaatgcttctgttgcggacttatgctggataactggaaacaaggagat
aatcctattgaaaagcataaaaagttgtatcctagctgtagctttgttcagaatctaaat
tcagttaacatctcaggagccacttctcagcctacttttccttcttcagtaacaaattcc
acgcacttattacttccaagtttggaaaacagtggctgtttcagtggctcttattcaagc
tttccatcaaatcttttaaactctggaccaaatcaagatttttctgccttgaggataagt
ccctaccattgtgcaatgaataccgaaaaagccagattacttactttccagatgtggcca
ttgacttttctgtcaccaacggatctggcaaaagcaggtttttactacataggacctgga
gatagagtggcctgctttgcctgtggtggaaaattgagcaactgggaaccaaaggatgat
gctatgtcagaacacctgagacatttccccaactgcccatttttaggaagtcagcttcaa
ggcacttcaagatacactgtttctaatctgagcatgcagacatatgcagcccgcttcaaa
acattctgtaactggccctctagtgttccagttcatcctgagcagcttgcaagtgcaggt
ttttattatatgggtcacagtgatgatgtgaaatgcttttgctgtgatggtgggctgagg
tgttgggaatctggagatgatccatgggtggaacatgccaagtggtttccaaggtgtgag
tacttgatacgaattaaaggacaagagttcatcagtcgagttcaagccagttaccctcat
ctacttgaacagctgttatctacttcagacaatccagaagatgaaaatgcagagtcacca
attgttcattttggacctggagaaaaccattcagaagatgcagtcatgatgaatacacct
gttgttaaagctgctttggaaatgggctttagtagaaggctgataaagcagacagttcag
agtaaaatcctaacaactggagagaattacagaactgtcagtgatcttgtattagattta
cttaatgcagaagatgaaataagggaagaggagaaagaaagagcaactgaggaaaaagaa
tcagatgacctatcattaatccggaagaatagaatggcactttttcaacgtttgacttgt
gcgcttccaatcctggatagtctactaactgccagagtgattagcgagcaagaacgtgat
gttattaaacaaaaaacacagacatccttacaagcaagagaactgattgatacgatctta
gtaaaaggaaattttgcagccaccatattcaaaaactctctacaagaaattgaccccatg
ttataccagcatttatttgtgcaacaagacataaaatacattcccacagaaaatgtttca
gatttaccaatggaagaacaattgaggcgactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgcggtcatctagtagtttgcaaagat
tgtgccccttctctaagaaaatgccctatttgtagaggtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Delphinapterus leucas (beluga whale): 111186670
Entry
111186670         CDS       T05885                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04120  Ubiquitin mediated proteolysis
dle04215  Apoptosis - multiple species
dle05145  Toxoplasmosis
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111186670 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    111186670 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186670 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111186670 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111186670 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111186670 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111186670 (BIRC7)
Peptidases and inhibitors [BR:dle01002]
 Peptidase inhibitors
  Family I32: IAP family
   111186670 (BIRC7)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    111186670 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_2 DUF2039 zf-C3HC4_4
Other DBs
NCBI-GeneID: 111186670
NCBI-ProteinID: XP_030618747
LinkDB
Position
Unknown
AA seq 361 aa
MERQGQRPDSALSWGGQDHMDGQILGQLRPLAEEEEEYGAGDAPSARPAFPGMGSEELRL
ASFCDWPLSAVVPPELLAAAGFFHTGQQDKVRCFFCYGGLQSWEQGDDPWTEHARWFPRC
EFLLRTKGRDFVCRVQESCCCVPGSWVFSGSFQDRSEEPEDAGPTTPSDAGGDQQQPAWS
QCPAVQAVLRMGFGRGQVQGLLQRKYRQGVPTGVSTSQLVADLLQEEDGGRAAGARAPVH
PGPELPTSSREAQLSGTREAVQRVEVRVWGDVTGPRCGDPGGAQAEGVPVALEAPGARDA
GMEKQLQRLREERTCRVCLDRAVAVVFVPCGHLACAECAPSLQLCPICRAPIRSCVRTFL
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggagcgtcagggccagcgccctgacagtgccctgtcctggggaggccaggaccacatg
gacgggcagatcctgggccagctgcgccccctggcagaggaggaggaggaatacggggcc
ggggatgccccatccgcgaggcccgccttcccggggatgggctccgaggagctgcggctg
gcctccttctgtgactggccactgagcgccgtggtgccgccggagctgctggccgctgcc
ggcttcttccacaccggccagcaggacaaggtgaggtgtttcttctgctacgggggtctg
cagagctgggagcaaggcgacgacccctggaccgagcatgccaggtggttccccaggtgt
gagttcctgctccggacaaaaggaagggactttgtctgcagggtccaggagtcttgttgc
tgtgtgccgggctcctgggtattctctggctccttccaggaccgttcagaggaaccagaa
gacgcaggtcccaccaccccctcagatgccgggggcgaccagcagcagcccgcctggagc
cagtgcccagcagtgcaggccgtgctccggatgggcttcgggcggggccaggtgcaaggg
ctgctgcagcgtaagtaccgccaaggggtgccgaccggcgtgtccacgtcgcagctggtg
gccgacctgctccaggaagaggacgggggccgggcagcaggggccagagctcctgtccac
ccagggccggagctgcccacgtccagcagagaggcccagttgtcaggcaccagggaggca
gtacagagggtggaggtcagggtgtggggcgatgtcacaggtccccgctgtggagaccca
ggtggagcccaggccgagggggtgccggtggctctcgaggccccaggagcccgggatgcc
ggcatggagaagcagctgcagcgcctgcgggaggagcggacgtgcagggtgtgcttggac
cgcgctgtggccgtcgtcttcgtgccctgcggccacctggcctgtgccgagtgcgccccc
agcctgcagctgtgccccatctgcagggcccccatccgcagctgcgtgcgcaccttcctg
tcctag

DBGET integrated database retrieval system