KEGG   Delphinapterus leucas (beluga whale): 111168262
Entry
111168262         CDS       T05885                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04630  JAK-STAT signaling pathway
dle04640  Hematopoietic cell lineage
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111168262 (IL3RA)
   04151 PI3K-Akt signaling pathway
    111168262 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111168262 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111168262 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111168262 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168262 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dle04050]
    111168262 (IL3RA)
   04090 CD molecules [BR:dle04090]
    111168262 (IL3RA)
Cytokine receptors [BR:dle04050]
 Interleukin receptor families
  IL3 receptor family
   111168262 (IL3RA)
CD molecules [BR:dle04090]
 Proteins
  111168262 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind Y_Y_Y InlK_D3 IL12p40_C
Other DBs
NCBI-GeneID: 111168262
NCBI-ProteinID: XP_022417593
UniProt: A0A2Y9MKA6
LinkDB
Position
Unknown
AA seq 473 aa
MDGLASVPGRLPVTGSSGSDPLPCPGKGSLGLPSTQFGKKDPGCRLLVSNLCESWHFWGT
RSVLGNLVGAPDLDGGAAGARPPVGAALAMAFVWLAVFLVPVSGLLPPDHDPYPIDISDP
DPPIKNLRMEPERKRLTWDLHGNVSEIMCFINSKAFTKARKRTYCSFLDLSCQATNYSIK
VTKGQPFSTWIQYPSQEGNPRAAAENLTCWVHDVDFLTCSWAVGREAPRDVQYNLYLENL
DSYEKWPCSQYRADEQGTNVQCRFHNISLLSKDQTRFLVNGTSSGSKIPCSETSDRLAKI
EVLAAPNITSRWCNQSYSFMQWQVRSHLNDDFKYELQIQKGTELPYKQEIYKAFLELNNP
GTYTVQVRARDATFSHYKPWGPWSVPQHFVCEEGARLPVWLTSLLIALGTLLAMGLVLRF
CRFSVMQKLFPPIPHMKDHINGKLQNGRTMTWDPDQDSQEECPVAEVQVLGET
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggatggtttggcatctgtcccgggacgcctccctgtgacgggcagttccggatctgac
ccgttgccttgtcctggaaaggggtctctcgggcttccctccacccagtttggcaagaag
gaccctgggtgtcggcttctggtgtcaaatctgtgtgaaagttggcacttttgggggacc
aggtcagtcctggggaatcttgtgggagccccagacctggatgggggagcagctggcgcc
cgccctcctgtgggagctgccttggccatggctttcgtctggctggcggtcttcctggtg
cccgtctccggcctgctgccaccggaccacgacccttaccctatagacatttccgatcca
gacccaccaattaagaacctaaggatggagccagaaagaaaaagattgacctgggacctc
catggaaacgtttccgaaattatgtgtttcatcaattcaaaagctttcactaaggcacgg
aaaaggacgtattgcagttttcttgacttgtcatgccaagctacaaactacagcatcaag
gtgaccaaaggtcagccattctccacgtggattcagtatcctagtcaagaagggaatccc
agggcggctgcagaaaacctgacctgctgggttcacgacgtggatttcctgacgtgcagc
tgggcggtgggccgggaggccccgagggacgtgcagtacaatctctacctggagaacctg
gactcctatgagaagtggccgtgctcccagtacagagcagatgagcaagggacaaacgtc
cagtgccgttttcacaacatctctctgttatccaaggatcagacgcgtttcctggtgaat
ggcaccagcagtggttccaaaatcccctgctctgaaacgagtgatagactagccaaaatc
gaggtattagctgctcccaacatcactagcaggtggtgtaaccaaagctactcgttcatg
cagtggcaagtgaggagtcaccttaatgatgacttcaagtatgaactgcagatacagaag
ggtacggagctcccctacaaacaggagatctataaagccttcttggagctgaacaatcct
gggacctacacggtgcaagtaagggccagggatgccaccttctcccattacaaaccttgg
ggcccgtggagtgtcccccaacacttcgtgtgtgaggagggcgcgcgcctccccgtctgg
ctgacgtctttgctgatcgcgctggggacgctgctggccatggggctcgtgctccggttt
tgcaggttctcggtgatgcagaagctgttccctcccatccctcacatgaaagaccatatc
aatggcaaacttcagaacggaaggacgatgacctgggaccccgaccaagacagccaggag
gagtgtccagtggccgaggtgcaggttctgggggaaacatga

DBGET integrated database retrieval system