KEGG   Delphinapterus leucas (beluga whale): 111168973
Entry
111168973         CDS       T05885                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle04270  Vascular smooth muscle contraction
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04613  Neutrophil extracellular trap formation
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04726  Serotonergic synapse
dle04730  Long-term depression
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04929  GnRH secretion
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05034  Alcoholism
dle05132  Salmonella infection
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111168973 (RAF1)
   04012 ErbB signaling pathway
    111168973 (RAF1)
   04014 Ras signaling pathway
    111168973 (RAF1)
   04015 Rap1 signaling pathway
    111168973 (RAF1)
   04370 VEGF signaling pathway
    111168973 (RAF1)
   04371 Apelin signaling pathway
    111168973 (RAF1)
   04630 JAK-STAT signaling pathway
    111168973 (RAF1)
   04068 FoxO signaling pathway
    111168973 (RAF1)
   04072 Phospholipase D signaling pathway
    111168973 (RAF1)
   04071 Sphingolipid signaling pathway
    111168973 (RAF1)
   04024 cAMP signaling pathway
    111168973 (RAF1)
   04022 cGMP-PKG signaling pathway
    111168973 (RAF1)
   04151 PI3K-Akt signaling pathway
    111168973 (RAF1)
   04150 mTOR signaling pathway
    111168973 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111168973 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    111168973 (RAF1)
   04218 Cellular senescence
    111168973 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111168973 (RAF1)
   04540 Gap junction
    111168973 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111168973 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111168973 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111168973 (RAF1)
   04625 C-type lectin receptor signaling pathway
    111168973 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    111168973 (RAF1)
   04660 T cell receptor signaling pathway
    111168973 (RAF1)
   04662 B cell receptor signaling pathway
    111168973 (RAF1)
   04664 Fc epsilon RI signaling pathway
    111168973 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    111168973 (RAF1)
   04062 Chemokine signaling pathway
    111168973 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111168973 (RAF1)
   04929 GnRH secretion
    111168973 (RAF1)
   04912 GnRH signaling pathway
    111168973 (RAF1)
   04915 Estrogen signaling pathway
    111168973 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    111168973 (RAF1)
   04917 Prolactin signaling pathway
    111168973 (RAF1)
   04921 Oxytocin signaling pathway
    111168973 (RAF1)
   04926 Relaxin signaling pathway
    111168973 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    111168973 (RAF1)
   04919 Thyroid hormone signaling pathway
    111168973 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    111168973 (RAF1)
   04916 Melanogenesis
    111168973 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111168973 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    111168973 (RAF1)
   04720 Long-term potentiation
    111168973 (RAF1)
   04730 Long-term depression
    111168973 (RAF1)
   04722 Neurotrophin signaling pathway
    111168973 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    111168973 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111168973 (RAF1)
   05206 MicroRNAs in cancer
    111168973 (RAF1)
   05205 Proteoglycans in cancer
    111168973 (RAF1)
   05230 Central carbon metabolism in cancer
    111168973 (RAF1)
   05231 Choline metabolism in cancer
    111168973 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111168973 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111168973 (RAF1)
   05212 Pancreatic cancer
    111168973 (RAF1)
   05225 Hepatocellular carcinoma
    111168973 (RAF1)
   05226 Gastric cancer
    111168973 (RAF1)
   05214 Glioma
    111168973 (RAF1)
   05221 Acute myeloid leukemia
    111168973 (RAF1)
   05220 Chronic myeloid leukemia
    111168973 (RAF1)
   05218 Melanoma
    111168973 (RAF1)
   05211 Renal cell carcinoma
    111168973 (RAF1)
   05219 Bladder cancer
    111168973 (RAF1)
   05215 Prostate cancer
    111168973 (RAF1)
   05213 Endometrial cancer
    111168973 (RAF1)
   05224 Breast cancer
    111168973 (RAF1)
   05223 Non-small cell lung cancer
    111168973 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111168973 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    111168973 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    111168973 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111168973 (RAF1)
   05152 Tuberculosis
    111168973 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111168973 (RAF1)
   05161 Hepatitis B
    111168973 (RAF1)
   05160 Hepatitis C
    111168973 (RAF1)
   05164 Influenza A
    111168973 (RAF1)
   05163 Human cytomegalovirus infection
    111168973 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111168973 (RAF1)
   05165 Human papillomavirus infection
    111168973 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111168973 (RAF1)
   01522 Endocrine resistance
    111168973 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111168973 (RAF1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111168973 (RAF1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   111168973 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 111168973
NCBI-ProteinID: XP_022418508
UniProt: A0A2Y9MMZ0
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGIPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHGESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHISNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgct
gtgtttgatggccccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaacttacggacccttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagttttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgatgctgcctcg
ttgattggagaggaacttcaagtagatttcctggatcatgttccactcacaacacacaac
tttgctcggaagaccttcctgaaacttgccttctgtgacatctgtcagaagttcctgcta
aatgggtttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttgctgttcccaaattccact
gttggtgatagtggaatcccagcactgccttctttgacaatgcgtcggatgcgagagtct
gtctcccggatgcctgttagttcccagcacagatactccacaccccacgctttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccttgcccgtggacagcaggatgattgaggatgca
attcgaagtcacggtgaatcagcctcaccttcagccttgtccagcagtcccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcaccg
ggatccagcacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
gggactgtttataagggcaagtggcatggagacgttgcagtaaagattctaaaggttgtt
gaccccacaccagagcagttccaggccttcaggaatgaagtggctgtccttcgcaaaacc
cggcacgtgaacatcctgctcttcatgggatacatgacgaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctataaacacctgcacgtccaggagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactacttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagactttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctccatcttgtggatggccccagaggtgattcgaatgcag
gacaataacccgttcagcttccagtctgacgtctactcttacggcatcgtgctgtacgag
cttatgacgggggagctgccctactcccacatcagcaaccgcgatcagatcatcttcatg
gtaggccgagggtacgcctccccagaccttagtaaactgtacaagaactgccccaaagca
atgaagaggctggtagccgactgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctttcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccataccgaggacatcaatgcctgcacgctgacc
acatcccctagattgcctgtcttctag

DBGET integrated database retrieval system