KEGG   Delphinapterus leucas (beluga whale): 111169176
Entry
111169176         CDS       T05885                                 

Gene name
ILK
Definition
(RefSeq) integrin-linked protein kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03320  PPAR signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle05100  Bacterial invasion of epithelial cells
dle05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169176 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111169176 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    111169176 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    111169176 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111169176 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111169176 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111169176 (ILK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111169176 (ILK)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: TKL group
  MLK family
   111169176 (ILK)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111169176 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 111169176
NCBI-ProteinID: XP_022418912
UniProt: A0A2Y9MIP5
LinkDB
Position
Unknown
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKMLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaatgcggttgccgtccgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagaaggccgatctgctgtggtcgagatgctgatcatgcgcggggcacgaatc
aatgtgatgaaccgtggggatgacacccctctgcacctggcagccagtcatgggcaccgt
gatattgtacagaagctgctgcagtacaaagctgacatcaatgcagtgaatgagcatggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaggtggcagaggacctcgtg
gctaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccttgagagagcttctccgagagcgggcagagaagatgggccagaatctgaac
cgtattccatacaaggacacattctggaaggggactacccgcactcggccccgaaatggg
actctgaacaaacactccggcattgacttcaaacagctcaacttcctggcgaagctcaat
gagaatcactctggagagctatggaagggccgctggcaggggaatgacatcgtcgtgaag
atgctgaaggttcgagactggagtacaaggaagagtagggacttcaacgaggagtgtccc
cggctcaggattttctcccacccgaatgtgctcccagtgctcggtgcctgtcagtcccca
cctgctcctcaccccaccctcatcacacactggatgccatatggatccctgtacaatgtg
ctacacgaaggcaccaatttcgttgtggaccagagccaggctgtgaagtttgcgctggac
atggcaaggggcatggcctttctacacacgctagagcccctcatcccacgacatgcactc
aacagtcgtagtgtaatgattgatgaggacatgactgctcgaatcagtatggccgacgtc
aagttctccttccagtgccccggacgcatgtatgcacctgcctgggtggcccctgaagct
ctgcaaaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaacatggaaatt
ggaatgaaggtggcactggaaggccttcggcctaccatcccaccaggcatttccccccat
gtatgtaaactcatgaagatctgcatgaatgaagaccctgctaagcggcccaagtttgac
atgattgtgcctatcctggagaagatgcaggacaagtag

DBGET integrated database retrieval system