KEGG   Delphinapterus leucas (beluga whale): 111169371
Entry
111169371         CDS       T05885                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05200  Pathways in cancer
dle05202  Transcriptional misregulation in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05231  Choline metabolism in cancer
dle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111169371 (PDGFA)
   04014 Ras signaling pathway
    111169371 (PDGFA)
   04015 Rap1 signaling pathway
    111169371 (PDGFA)
   04630 JAK-STAT signaling pathway
    111169371 (PDGFA)
   04020 Calcium signaling pathway
    111169371 (PDGFA)
   04072 Phospholipase D signaling pathway
    111169371 (PDGFA)
   04151 PI3K-Akt signaling pathway
    111169371 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111169371 (PDGFA)
   04540 Gap junction
    111169371 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111169371 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111169371 (PDGFA)
   05202 Transcriptional misregulation in cancer
    111169371 (PDGFA)
   05206 MicroRNAs in cancer
    111169371 (PDGFA)
   05231 Choline metabolism in cancer
    111169371 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    111169371 (PDGFA)
   05218 Melanoma
    111169371 (PDGFA)
   05215 Prostate cancer
    111169371 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111169371 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111169371 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111169371 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111169371 (PDGFA)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111169371 (PDGFA)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111169371 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 111169371
NCBI-ProteinID: XP_022419239
UniProt: A0A2Y9MAM4
LinkDB
Position
Unknown
AA seq 196 aa
MRTWACLLLLGCGYLASALAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGAEEPLE
TSLRAHGGRGAKHALEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECTCA
SVSPSPGHREEEADVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgtttgctgctcctcggctgcggatacctcgccagtgccctggcc
gaggaagccgagatcccccgcgaggtcattgagaggctggcgcacagtcagatacacagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggagcctttggag
accagcctgagagcccacgggggccgtggcgccaagcatgcactggagaagcggcctgtg
cccattcggaggaaaagaagcatcgaggaagccatccccgcagtctgcaagaccaggacg
gtcatttatgagatacctcggagccaggtggaccccacgtctgccaactttctgatctgg
cccccgtgcgtggaggtgaagcgctgtaccggctgctgcaacaccagcagtgtcaagtgc
caaccatcccgcgtccaccaccggagtgtcaaggtggccaaggtggagtacgtcaggaag
aagccaaagttaaaagaggtgcaggtgcggctggaggagcacctggaatgcacgtgcgcg
agcgtcagcccgagccccggccaccgggaagaggaggcggatgtgaggtga

DBGET integrated database retrieval system